(data stored in ACNUC30630 zone)

EMBL: BX251410.PE188

BX251410.PE188       Location/Qualifiers
FT   CDS_pept        241271..242053
FT                   /transl_table=11
FT                   /locus_tag="TW203"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter ATP-binding subunit"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivG or b3455 or z4825 or ecs4302 SWALL:LIVG_ECOLI
FT                   (SWALL:P22730) (255 aa) fasta scores: E(): 4.7e-36, 47.43%
FT                   id in 253 aa"
FT                   /protein_id="CAD66880.1"
FT                   /translation="MQDALLQSEHLLDVRDLVVRFGGIVALDGVSFSVGRGEILALIGP
FT                   NGAGKTTLFNVITGVYRPTSGDVSLESVSLKSVKRYRIARMGIARTFQNIRLFGGMTVL
FT                   ENVAVGLGVHHKTHILGALFRTPRHCREEREIVERGLEILDMVGIAQDAYKLAGSLSYG
FT                   SQRRLEIARALACQPKLLCLDEPAAGFNPAEKNQLVELILKIRDAGYSILLIEHDMKLI
FT                   FDVADRVVVLDFGKKIADGLPDDVRNDPHVIAAYLGEG"
     atgcaagacg cgctgttaca gtctgagcat cttcttgatg tgcgtgatct cgttgttcgc        60
     tttgggggta ttgtcgcgct cgacggcgtc tcgttcagtg ttggcagggg cgagattctg       120
     gcgctcattg gccccaacgg cgcgggtaaa acaacccttt tcaacgtcat aacgggtgtt       180
     tatcgaccaa cctcgggcga tgtatctctt gaatctgtgt ctttgaaatc ggtaaagagg       240
     tatcgcatag cccgtatggg aattgcgaga acttttcaga atattcggct attcggcggt       300
     atgaccgttt tagagaacgt cgcagttggg cttggagtgc atcacaaaac ccatatattg       360
     ggtgcgctct ttagaacccc caggcattgc agggaagagc gtgaaattgt ggagcgaggc       420
     cttgagattc tcgatatggt cgggatcgcc caggatgcct ataaactcgc gggcagtctg       480
     tcttatggca gccagaggcg ccttgagatc gccagggctc ttgcttgtca gccaaagttg       540
     ctttgcttag atgagccagc agctggcttt aatcctgctg aaaaaaatca actcgtggag       600
     ctaattttaa aaatccgtga tgcgggatat tcaatcctat tgattgagca tgatatgaag       660
     ttgatttttg atgttgctga tagagtggtt gtccttgatt ttggtaagaa aatcgccgat       720
     ggattgccgg atgatgtgcg taatgatcct catgttattg ccgcctatct cggggaaggg       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page