(data stored in ACNUC30630 zone)

EMBL: BX251410.PE189

BX251410.PE189       Location/Qualifiers
FT   CDS_pept        242078..242761
FT                   /transl_table=11
FT                   /locus_tag="TW204"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter ATP-binding subunit"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivF or b3454 SWALL:LIVF_ECOLI (SWALL:P22731) (237 aa)
FT                   fasta scores: E(): 1.4e-33, 52.42% id in 227 aa"
FT                   /protein_id="CAD66881.1"
FT                   /translation="MNVSYGKIRVLYDISFTVNRGEIVSLIGSNGAGKTTLMRTISGLL
FT                   NTSGKILFQGEDITKYAPYKRVLSGISQSPEGRGVFPGMTVRENLDMGAYARKDRKNIK
FT                   DDFDRVYGLFPRLLERRDQLGGAMSGGEQQMLAIARAIMSRPKLLLLDEPSMGLAPQLI
FT                   QQIFSIVREINRQGVTILMVEQNANQSLGISDHAMVLETGNITRTGTGKELLQDGSIRK
FT                   AYLGV"
     gtgaatgtca gttacgggaa gattcgtgtg ttgtacgata tctcgtttac ggtaaatcgg        60
     ggcgagatag taagtttgat tggttcaaac ggtgcgggta aaaccactct tatgcgcacc       120
     atatctggcc ttctgaacac gtcgggtaaa atcctttttc aaggtgagga tataactaag       180
     tatgctccct acaagcgtgt tctttctggt atttcccagt ccccagaggg gaggggggtt       240
     ttcccaggca tgacagttcg ggaaaacctt gacatggggg cttatgcgag aaaggatcgt       300
     aagaatataa aggatgattt cgacagagtt tacgggcttt ttccgcgttt gcttgagcgt       360
     cgtgatcagt tgggcggggc tatgtcgggc ggtgagcagc aaatgcttgc gattgcccgt       420
     gcgattatga gtaggccaaa actgcttttg ctggatgagc cgtctatggg ccttgcgcct       480
     caacttattc agcagatttt cagtattgtg cgtgagatta atcgtcaggg ggttaccatc       540
     ctcatggttg agcaaaatgc gaatcagtca ttgggaatat cggatcatgc aatggtcctg       600
     gagactggga atattacccg tacgggaacc ggaaaggagt tattacaaga cgggtccata       660
     aggaaggcat acctgggggt ctag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page