(data stored in ACNUC30630 zone)

EMBL: BX251410.PE19

BX251410.PE19        Location/Qualifiers
FT   CDS_pept        18975..20372
FT                   /transl_table=11
FT                   /locus_tag="TW019"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   dihydrolipoamide dehydrogenase/glutathione oxidoreductase
FT                   and related enzymes cgl0688 SWALL:BAB98081 (EMBL:AP005276)
FT                   (469 aa) fasta scores: E(): 6.5e-76, 48.58% id in 459 aa,
FT                   and to Bacillus subtilis dihydrolipoamide dehydrogenase
FT                   PdhD or AceD or CitL SWALL:DLD1_BACSU (SWALL:P21880) (470
FT                   aa) fasta scores: E(): 1.6e-35, 30.99% id in 442 aa"
FT                   /protein_id="CAD66711.1"
FT                   /translation="MSVKKNHKIVVIGGGPGGYSAALSGALLGADVVLIENQAVGGSAT
FT                   LTDVVPSKTLIASAERAVFVAQGADFGIRFQNCVSADIGHINRRIMDLTRAQSADMFST
FT                   LTGAGVRVVYGHAALDGPNRVLVSVSGQEKYEFFANTVVVATGSSPRVLPNAIPDGKRI
FT                   LTWKQLYTLEQVPEHIIVVGSGVTGAEFASAFRNLGSEVTLVSSRDRVLPGGDEDAADL
FT                   IQEVFINSGMKLLNRARAQAAAACNGGVVVTLTDGTEVRGTHCLMAVGSVPNTSGIGLE
FT                   TANIALNPAGRITVNRVACSSVPGVYAAGDCSDFLPLASVAEMQGQVAVYHAMGENANP
FT                   IELKNLASTVFTTPEIATVGRSEKAIDKARATALKVDLATNSRAKILGIKTGFVKMIVS
FT                   RETGTVLGGVVVAPNASDLIFPISVAVQNRLSADQLSQSFAVYPSLTISLWHAARASHV
FT                   RTDSASP"
     gtgtctgtca agaaaaatca taaaatagtt gttattggcg gtggcccagg tggttattca        60
     gcggctctga gcggtgccct gcttggcgct gatgttgtgc tgattgagaa tcaggctgtc       120
     ggcgggtctg cgactttaac agacgttgtt ccctcaaaaa cacttattgc ctcggcagag       180
     cgggctgttt ttgttgccca gggtgctgat tttggtattc gttttcagaa ctgcgtttca       240
     gccgatatag ggcacataaa ccggcgaatt atggatctta ccagagctca aagtgctgat       300
     atgttctcga ccttgactgg tgctggggtt agggtagttt atggccatgc cgctttggat       360
     ggaccgaatc gggttcttgt atcggtgtca ggtcaagaga aatatgagtt ctttgcaaat       420
     acggttgttg ttgcaacagg ttctagtcca agggttttac caaatgccat tcctgacggg       480
     aagagaatac ttacatggaa acagctttat acccttgagc aggttcctga gcatatcatt       540
     gtagttggct cgggcgtgac tggcgctgaa tttgcatcag ctttcaggaa tttaggaagc       600
     gaagttacac tggtttccag cagggacagg gtgttacctg ggggagatga agatgctgca       660
     gatttgattc aggaagtttt tataaattcg ggaatgaaac tgctcaaccg ggcacgtgct       720
     caagccgccg cagcctgcaa tgggggtgtt gtggtaaccc ttaccgacgg tacagaggtg       780
     cgcgggaccc attgcctaat ggctgttggc agtgttccta atacttctgg gattggttta       840
     gaaacagcga atattgcact gaatccagca gggcgaatta cggtaaatag agtggcctgt       900
     tcaagcgttc ccggggtata tgcggcaggg gactgttcgg attttttacc ccttgcatct       960
     gttgccgaga tgcaaggcca ggttgccgtt tatcacgcaa tgggggagaa tgctaatcca      1020
     attgaactta aaaatttagc ctcaacagtt tttacaaccc cggaaattgc cactgttggt      1080
     aggtccgaga aggctataga caaagccagg gccaccgccc tgaaggttga cttagcaaca      1140
     aattcccgtg caaaaattct gggtataaag acgggcttcg ttaagatgat tgtatctcgt      1200
     gaaacaggca ccgtacttgg cggtgttgtt gttgcaccaa atgcaagtga cttaattttt      1260
     ccaatatcgg ttgctgttca aaatcgcctt agcgctgatc aattatcaca aagctttgcc      1320
     gtctatccgt ccctaacaat atctttgtgg cacgcagccc gcgcttcgca cgtgagaacc      1380
     gacagcgcgt cgccctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page