(data stored in ACNUC30630 zone)

EMBL: BX251410.PE20

BX251410.PE20        Location/Qualifiers
FT   CDS_pept        complement(20441..22216)
FT                   /transl_table=11
FT                   /locus_tag="TW020"
FT                   /product="putative acyl-CoA carboxylase complex A subunit"
FT                   /note="Similar to Streptomyces coelicolor putative acyl-CoA
FT                   carboxylase complex A subunit AccA1 SWALL:Q9RGQ6
FT                   (EMBL:AF113603) (590 aa) fasta scores: E(): 2.3e-110,
FT                   51.67% id in 596 aa, and to Mus musculus pyruvate
FT                   carboxylase, mitochondrial precursor SWALL:PYC_MOUSE
FT                   (SWALL:Q05920) (1178 aa) fasta scores: E(): 1.6e-71, 42.26%
FT                   id in 504 aa"
FT                   /protein_id="CAD66712.1"
FT                   /translation="MKKITRLLIANRGEIAVRVIRACRDKAIASIAIYSDQDRDAVHTQ
FT                   LADEAYCLEGETAAETYLNIEKILDIAKLSRADGIHPGYGFLAESPEFAEAVSSAGITW
FT                   VGPRAGVIALLADKLSARKIAEQVGVPVPPGGEHVVSCASEVHNFADKYGLPIAIKAAY
FT                   GGGGLGMKVVKQKKNIDELFASAQREAQAAFGNKECFIEKYIDRPRHVETQCLADLFGN
FT                   VQVVSTRDCSVQRRHQKLIEEAPAYTLTDKQEETLITASKAVMKAAEYSGAGTCEFLID
FT                   QDGKIFFLEVNARLQVEHPVTEEITGIDLVLEQINIAEGKLLKNLETPVYKGHSLEFRI
FT                   NAEDANSGFMPRHGKVVKFEPPGGLGIRIDSGIKAGDTIGAAFDSLLCKLIVTGNNREC
FT                   ALARARRALDEFVIDGVTTLIPFHRNILNQPDFINGGMYTGWVENEYSKLVNKQTDAST
FT                   VPDIQDTLSVSKNLREIIVEVNRKQIRVRLPSPIGEYPTERQKPPGRRVGHNFRQKTQE
FT                   KNPDSIFSPMQAVVVKVNVTEGQSVKKDDLLIVLEAMKMEQPIVAPRDGVVEKINAHTG
FT                   ETVPSGHELLRLKKV"
     atgaaaaaaa taacccgact attgatagcg aaccgcggcg aaatagcggt aagggttata        60
     cgtgcctgtc gcgataaagc aattgcctcc attgcaatat attcggatca agacagggat       120
     gcggtacata ctcaacttgc ggatgaagct tactgcctgg agggtgaaac cgctgccgaa       180
     acctacctaa acatagagaa aatactcgat atagcaaaac tcagtcgggc agatggaata       240
     catccgggat acggctttct tgccgaaagc cccgaatttg ctgaagcggt atcaagtgcg       300
     ggtattacat gggtcggtcc acgcgcaggg gtcatagcgc tcctggcaga caaattatcg       360
     gcacgaaaga ttgcagaaca ggttggagtg ccggtccccc cgggtggcga acatgtggtc       420
     tcttgtgcat ctgaagtgca taattttgca gacaagtatg gacttccaat tgcaataaag       480
     gctgcgtatg gcggtggtgg tcttggcatg aaagttgtaa aacaaaaaaa gaatatagat       540
     gagcttttcg catcagcaca acgtgaagcg caggcggcat tcggaaacaa ggaatgtttc       600
     atagaaaaat atattgatag accacgacat gtagaaacac aatgtctggc tgatctgttt       660
     ggcaatgtac aagtcgtttc cacgcgagac tgttccgtgc agcgcagaca ccaaaaacta       720
     attgaagaag cgcccgccta cacgctgaca gataaacaag aagaaaccct tatcaccgcg       780
     agcaaggctg ttatgaaagc agctgaatat tcaggtgcag gcacctgcga atttctcatt       840
     gaccaagatg ggaaaatatt ttttctggaa gttaatgcaa ggcttcaagt tgaacaccca       900
     gtaacagaag agataaccgg aattgatctc gttctggagc agataaatat agctgaggga       960
     aagctgctca aaaaccttga aacacccgta tacaaaggac atagtctgga gtttaggata      1020
     aatgctgagg atgcaaacag tggttttatg ccgagacatg ggaaggttgt aaaattcgaa      1080
     ccccctggcg gtctaggaat tcgtattgat agtggaataa aggcgggcga tacaataggg      1140
     gcagcctttg attctctgct gtgcaaactc attgttacgg gaaacaatag ggaatgcgct      1200
     ttggcacgtg ccaggcgggc tcttgatgag tttgtaattg acggtgtgac aacgcttatt      1260
     ccgttccaca ggaatattct caatcaaccc gacttcataa atggagggat gtatacgggt      1320
     tgggtggaaa acgaatatag caagctagtt aacaagcaaa ctgatgcaag tacggtgccg      1380
     gatatacaag acactctgtc tgtatcaaaa aatttaagag aaataattgt tgaggtaaac      1440
     agaaaacaaa ttagagtgcg cctgccatcc cccatagggg aatatcccac agaaaggcaa      1500
     aaacctcccg gcaggcgggt agggcacaat ttcagacaga aaacacagga gaagaacccc      1560
     gattctattt tttcgccaat gcaagcggtt gttgtgaaag taaatgttac ggaaggccag      1620
     tccgtcaaaa aagacgacct gttaatcgtg cttgaggcca tgaaaatgga acagccgata      1680
     gtggccccac gagatggggt agttgaaaaa atcaacgcgc acacaggcga gacagtgcca      1740
     agcggtcacg aattgttacg cttgaagaag gtttga                                1776
//

If you have problems or comments...

PBIL Back to PBIL home page