(data stored in ACNUC30630 zone)

EMBL: BX251410.PE21

BX251410.PE21        Location/Qualifiers
FT   CDS_pept        complement(22333..22752)
FT                   /transl_table=11
FT                   /locus_tag="TW021"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66713.1"
FT                   /translation="MVNMTKTEARAANAAFWQYPAHQPQQRPEFTTDSISRAHTTYMYA
FT                   QYRYATHWACTLLRVIHLSREEETAAALAAIMFIESESCRDVNSKAINKTTDCCNERNT
FT                   KNNWNIRVWSTRSWPSGGTLLPRKYEPLICRQWAR"
     atggtcaaca tgacaaagac agaggccagg gcggcaaacg cagcattttg gcagtacccg        60
     gcacatcaac ctcaacaaag accagaattc accacagaca gtatatcacg ggcgcataca       120
     acctatatgt acgcccaata cagatatgcc acacattggg cgtgtacact actgagagtg       180
     attcacctaa gcagagaaga agagactgcc gcagcccttg cggcgataat gtttattgag       240
     tcggaatcct gccgtgacgt gaatagcaag gcaataaata aaacgactga ttgttgcaat       300
     gaaagaaaca caaaaaacaa ctggaatata agagtatggt ccacgcgcag ttggccatcg       360
     ggtggtacac tgctgccgcg aaagtacgaa ccactgatat gtaggcaatg ggcacgctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page