(data stored in ACNUC30630 zone)

EMBL: BX251410.PE22

BX251410.PE22        Location/Qualifiers
FT   CDS_pept        22844..23152
FT                   /transl_table=11
FT                   /locus_tag="TW022"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66714.1"
FT                   /translation="MDFDPGKCVIGAINKVFSVDSISTTVGFTLLDKMVKVLKVSIKLT
FT                   RLINFSSIVLTAIDAVTGCLEGGIVSTETPVHPVPIVSSDCSAYDMGHKLGYRCQRR"
     atggatttcg atccgggaaa gtgtgtaata ggcgcgataa ataaagtttt tagcgttgac        60
     agtattagca ctactgttgg ttttacctta ctggacaaga tggtgaaggt cctgaaggtt       120
     tctataaagc taactcgcct tatcaacttt tccagcattg tcctgactgc aattgatgcg       180
     gttactggtt gtcttgaggg gggtattgtc tcgactgaaa cgcctgtgca tcctgtgccc       240
     attgtaagct cggattgcag tgcatatgac atggggcata aacttggcta tcgttgtcag       300
     aggaggtag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page