(data stored in ACNUC30630 zone)

EMBL: BX251410.PE220

BX251410.PE220       Location/Qualifiers
FT   CDS_pept        complement(259491..260606)
FT                   /transl_table=11
FT                   /locus_tag="TW235"
FT                   /product="putative MRP-family ATP-binding protein"
FT                   /note="Similar to Mycobacterium tuberculosis Mrp protein
FT                   homolog or rv1229c or mt1267 or mtci61.12c or mtv006.01C
FT                   SWALL:MRP_MYCTU (SWALL:O33225) (381 aa) fasta scores: E():
FT                   1.2e-45, 43.83% id in 365 aa"
FT                   /protein_id="CAD66912.1"
FT                   /translation="MIEKKLYSAMEKVYDPELHIPITRLGMVKTITTDSKTVSILIHIT
FT                   SPTCPAVDKIKQRVTDAASAVCPEHDIKIEIGVMSHQERQNLKEVLNLQKRSNPFKESK
FT                   TRIIAVTSGKGGVGKSTIVSNLGVGLARMGFSVSVIDADVYGFSIPRMFGIDEDFIPQR
FT                   ENGMIMPANKFGVKLISIGMFMRRRGAVAWRGPLLHRTINQFLCDVNFADPDILLIDMP
FT                   PGTGDAAITIAQLLPNSEVLVITTPQIVAADVAIRSGQFALSVKQNIIGVVENMSSCPE
FT                   SKLDIFGHGGGKFVAEFLDKQCKKESTAKDNRITNPHEAIDLITCIPLDVNIRKSGDEG
FT                   VPLLVENKYEGSPGHTALKELYEKIALKLYG"
     gtgatagaaa aaaaactcta ttccgcgatg gagaaggtgt atgatcctga gctccacata        60
     ccaatcacac gcctcgggat ggtaaaaacc ataaccacag atagcaaaac agtctcaatt       120
     cttatacata taacatcccc gacttgccca gcggtggaca aaataaaaca aagagttacc       180
     gacgcagctt ctgccgtgtg ccctgagcac gatataaaaa ttgaaatagg cgttatgtcg       240
     caccaagaac gtcaaaacct gaaagaggtt ctcaatttac aaaaacgcag caacccgttt       300
     aaagaatcaa aaacaagaat tatcgctgtt acaagcggca aaggtggagt gggtaaatca       360
     accatagtat ctaatctcgg tgttggcctc gcgagaatgg gcttttctgt atcagtaatt       420
     gatgctgatg tttatggttt ttctatacca cgaatgttcg gcatagatga agattttatt       480
     ccacagagag agaatggcat gataatgcct gccaataaat ttggcgttaa gctcatttcc       540
     ataggaatgt tcatgcgccg tcgaggggca gttgcgtggc ggggaccgct gcttcacaga       600
     acaatcaatc aatttctatg tgatgtgaat tttgctgacc cagatattct tctaatcgat       660
     atgcctcccg gcacaggaga tgcggcaata actattgcac agttattgcc gaattctgaa       720
     gtgctagtca taacaactcc gcagattgtt gccgctgatg ttgcaattcg aagtgggcag       780
     ttcgcccttt ctgtaaaaca gaacattatc ggtgtggttg aaaatatgtc atcttgcccg       840
     gaaagtaaac tagacatttt tggccatggc ggtggtaagt tcgtggcaga atttttggat       900
     aaacaatgca aaaaagagag caccgcgaaa gataacagaa ttaccaatcc tcatgaagca       960
     atagatctaa taacatgcat tccgttggat gtgaatatac gcaaaagtgg ggatgaaggg      1020
     gtgccgctac tcgttgaaaa caagtatgaa ggaagcccag ggcatactgc actcaaagag      1080
     ctttacgaaa aaattgcctt gaaactttac ggataa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page