(data stored in ACNUC30630 zone)

EMBL: BX251410.PE221

BX251410.PE221       Location/Qualifiers
FT   CDS_pept        complement(260614..261108)
FT                   /transl_table=11
FT                   /locus_tag="TW236"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   protein Rv1231c or mtv006.03c or mt1269 SWALL:O86314
FT                   (EMBL:Z98260) (180 aa) fasta scores: E(): 1.4e-09, 39.25%
FT                   id in 135 aa"
FT                   /protein_id="CAD66913.1"
FT                   /translation="MKKSSKLHTPLLTSRMRLRYNPGVFEMRTERIALYMGTASFFIFF
FT                   TTFCILWILWSNYAPNGLRFDSAEIGYPVLTLVLSVLAAYAAPLILLAEIRQWKRESLN
FT                   MKQMREMADRNIASTEYLAREVADLRLSIAQLITDQQKNNNRLKRLEETEKTIQDFGND
FT                   S"
     atgaaaaaga gtagcaagtt acacactccg cttttaacat cgcgcatgag gttgaggtat        60
     aaccctggtg tttttgaaat gcgaaccgag aggattgcgc tctatatggg cacagcctca       120
     ttcttcattt ttttcacaac attttgtatt ctctggattc tttggagtaa ctatgctcca       180
     aacggtctta gatttgacag tgcagaaatt ggatatccgg ttctaacact tgttctttct       240
     gtgctagctg cgtacgcagc accattgatc cttttggcag aaattagaca gtggaagcgt       300
     gaaagtctga acatgaaaca aatgcgcgaa atggccgacc ggaatattgc cagcacagaa       360
     tatctggcgc gtgaagttgc cgatttaagg ttatcaatag cacagctaat tacagatcaa       420
     cagaaaaaca ataaccgact gaagcgcctt gaggagacag aaaaaaccat acaggacttc       480
     gggaacgatt cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page