(data stored in ACNUC30630 zone)

EMBL: BX251410.PE223

BX251410.PE223       Location/Qualifiers
FT   CDS_pept        complement(262339..263508)
FT                   /transl_table=11
FT                   /locus_tag="TW238"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /note="Similar to Streptomyces coelicolor Xaa-Pro
FT                   aminopeptidase I PepP1 or SCO3970 or SCBAC25e3.07c
FT                   SWALL:AMP1_STRCO (SWALL:Q05813) (490 aa) fasta scores: E():
FT                   6.8e-55, 43.76% id in 409 aa, and to Escherichia coli
FT                   Xaa-Pro aminopeptidase PepP or b2908 SWALL:AMPP_ECOLI
FT                   (SWALL:P15034) (440 aa) fasta scores: E(): 1.9e-26, 35.63%
FT                   id in 275 aa"
FT                   /protein_id="CAD66915.1"
FT                   /translation="MRCRANDTFYRYRPDSSFTWLTGWGCETTPGAVLVIYPDTKPVLF
FT                   FKPPAGKKNDDFFTDSHNGTFWIGSRPSLQEIETLLGITCRDIKDFRCPTDNVLLCKTR
FT                   GKDAEEINDLKVAISELRLLKDRWEITQLQKAVDATAQGFERVVKSINEAKSVTNGERV
FT                   IEGAFYTSARSLGYETGYETIVAAGANACILHWSVNNGPINDGDLLLVDAGIELETLYT
FT                   ADITRTVPISGKFTDVQAKAYEAVLEAADAAFDAAMPGQPFHKMHEAAMGVIRRHLSEW
FT                   GICKASQNEFYRRYMIHGTGHHLGLDVHDCAFAKRENYRNGTLADGMVLTIEPGLYFHK
FT                   NDLTVPKDFRGIGVRIEDNILIASDGPVNMSRDIPRARIDVEQWIQQAS"
     atgcgatgcc gcgcaaacga taccttctac agatacaggc cagatagttc atttacctgg        60
     cttacaggat ggggatgtga aactacccca ggtgccgttt tggttatcta tcccgacacg       120
     aagccggtac tgttctttaa gccaccggct ggaaaaaaaa acgatgactt ctttacggat       180
     tctcataacg gtacattctg gataggatct aggcccagtt tgcaggaaat agagactctt       240
     ttgggcatta cgtgccggga tataaaggac tttagatgcc caacggataa tgtgctctta       300
     tgcaagacaa gaggcaagga tgctgaagaa attaacgact tgaaggttgc aataagcgaa       360
     ctgagacttt tgaaggatag atgggaaatc acccaattac aaaaagcggt cgatgctact       420
     gctcagggct ttgagcgcgt cgtgaaatcg ataaacgagg ccaaatctgt tacgaatggt       480
     gagcgcgtaa tcgaaggtgc attttacact tctgctagaa gtctgggtta tgaaacaggc       540
     tacgagacga ttgttgctgc gggtgccaac gcatgtattt tgcactggtc tgtaaataat       600
     ggcccgatta atgatggtga tctgttgctt gttgatgctg ggattgagct tgagactttg       660
     tacacagcgg atataaccag aacagtcccc ataagtggaa aatttaccga tgtacaagct       720
     aaagcctatg aggctgtcct tgaagctgct gatgcagcgt ttgacgcggc catgcccggt       780
     cagccgttcc acaaaatgca cgaagctgca atgggggtta tacgccgaca cctctccgaa       840
     tggggtattt gtaaggcctc gcaaaacgag ttttatagaa gatacatgat ccacggaacg       900
     ggacatcacc taggattgga cgtgcatgac tgtgcctttg ccaagcgcga gaattatcgt       960
     aatggaacgc ttgcagatgg catggtgctt accatagagc cgggattgta ttttcacaaa      1020
     aatgacctaa ctgttccgaa ggactttcga ggaattgggg taagaatcga agataacata      1080
     ctcatagcct cagatggccc tgtaaatatg tcgcgtgata taccaagggc ccgaattgat      1140
     gtggaacagt ggattcaaca agcatcatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page