(data stored in ACNUC30630 zone)

EMBL: BX251410.PE224

BX251410.PE224       Location/Qualifiers
FT   CDS_pept        263951..264562
FT                   /transl_table=11
FT                   /locus_tag="TW240"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66916.1"
FT                   /translation="MGISEAHTPHKDIHLDVGLISAQIILLRNIFSTALGNIRACDSYA
FT                   ASLIKRSESVQKCSKAPKEVFRAELVGAALSVQQLMSGRGEYVDLMSYFLISELMRDFH
FT                   LLALSHLEVSEKYRIEELTCVDLKDKKKLSREIFRLLSRIARNDSTLSSMMSLWGRRIL
FT                   GDVLLFIKLCIGQDHNNSRSLLSTLAGKHSERMRAIGLIA"
     atgggtattt cagaggcaca tacaccgcac aaggatattc atctagatgt ggggttaatt        60
     tccgctcaaa tcattttgct tcgtaacata ttttcaaccg cacttggcaa tattcgcgcg       120
     tgtgattcat atgccgccag tttgattaaa cgctctgaat cagttcagaa gtgttctaaa       180
     gcaccgaaag aggtgtttag ggccgaactt gttggggccg ccttgtccgt gcagcaactc       240
     atgtccggaa ggggtgaata cgtagacttg atgagctatt ttcttatatc cgagctgatg       300
     cgggattttc atcttctagc cctatctcat cttgaggtca gtgaaaaata taggattgag       360
     gagctaacat gcgtggattt gaaggataag aaaaaactta gtcgtgaaat ttttcgcctt       420
     ttatcgcgaa tagcaagaaa cgattcaacg ctatcctcaa tgatgtcgct ttgggggagg       480
     cgcattctgg gtgatgtttt gctttttatc aagttgtgta ttggtcaaga tcacaataac       540
     tcacgatcct tactatccac ccttgccgga aagcactcag agcgcatgag ggcaattggc       600
     ctgatcgcct ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page