(data stored in ACNUC30630 zone)

EMBL: BX251410.PE225

BX251410.PE225       Location/Qualifiers
FT   CDS_pept        complement(264653..264874)
FT                   /transl_table=11
FT                   /locus_tag="TW241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Corynebacterium glutamicum hypothetical
FT                   protein Cgl0772 SWALL:BAB98165 (EMBL:AP005276) (75 aa)
FT                   fasta scores: E(): 0.0016, 34.72% id in 72 aa"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66917.1"
FT                   /translation="MELKIGIANCIKEISFHVDITHEQLLQKVNDAVGNHGVLNLKDTG
FT                   GEEIIIPGSALAYVWIVQEKKRVCGFVS"
     gtggaactaa agatcggtat tgcaaattgc ataaaggaaa tatcctttca tgtggatata        60
     acccatgagc aattattgca gaaggtcaat gacgctgtgg gtaaccacgg ggtgctcaac       120
     ctcaaagaca cggggggcga agagatcatc atcccgggat ccgctctggc atatgtctgg       180
     attgttcagg aaaagaagcg cgtttgcggg ttcgtatcct ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page