(data stored in ACNUC30630 zone)

EMBL: BX251410.PE226

BX251410.PE226       Location/Qualifiers
FT   CDS_pept        264900..267881
FT                   /transl_table=11
FT                   /locus_tag="TW242"
FT                   /product="putative ATP-dependent DNA helicase subunit"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ATP-dependent DNA helicase SCO5183 or 2SC3B6.07
FT                   SWALL:Q9FCK5 (EMBL:AL390968) (1159 aa) fasta scores: E():
FT                   2.7e-07, 24.49% id in 1139 aa"
FT                   /protein_id="CAD66918.1"
FT                   /translation="MFMDISECSLPDAIDSIARIPEGSRVSVIGPPGSGKTSLLLSLLE
FT                   KYSESFEPEEVLVLAPGRLLANRLNGIALPALLKEKKVRSGRLVVTPASFAFRIVQNSM
FT                   KGERPTLLSGADEDQVIAETIAQNCELFKSSYARSPNFRSRMRFFIEDLSRHGIDPAHL
FT                   GKIDRWKTYAALIEKYRLARTSNNAFTAVEIIERAAQLASTGYLPYRVIMVDEAQELAA
FT                   EHMRLFSALARRNITVILFGDPDKAVARSASPSIFLDFSEKLFVLKTVFRTPRNLHLLS
FT                   QKICQGIGVTGSVLAHRQSFNSSILEGRVETVISSSRATSMADIARWFREKHLLEGIDW
FT                   EDMALIIFQRSSAEVYSHFLERFGVPVQILGGGLNLSEKPIAGAILNAIELACFPDILT
FT                   GKTLVKLLLSPIGGFDVFLMRKLTIELKRIAPKNIQVLNERLLWAFHAYRKLQTQDTDE
FT                   VYRVFLASRIGRSLKKIFECLISLERLYREDNVSLPVLIWHVYSFLNLKSAVSKEPWQT
FT                   SKVSHRVLEEVIALQKLADAVSKKDPLCSAGLILQKIINAEVPVDNLSIREKRGCVTIL
FT                   TPASSVGYEYRAVVITDIQGSHKMDSTQLDPELALADINNIPFSRYLESKLAGRRHNLL
FT                   RTLYQAVTRSTSDLLVSVIDSAETSPSWLFYAFFSDYPSCELSSLPLTLRGIVTQLRLD
FT                   LERDPGNTEAASALRLLAKEGISQADPQNWYGYLSRTENKSYVMDSIKPSALDKFHTCP
FT                   LGWFTDQLDCNRYPGNATEIGTIIHRCMQELTCDNRQPNLNEFLDYAYAKLREADFESR
FT                   WVLEREKKRLVGIIRKLVDYLIDFDAHGGTLLASEKSFSFDLNVFKDRSIMISGQIDRL
FT                   ERLSSGEIRIVDLKTGSSLLSKNDAESNLQLSAYQLAVEHLDIVYETLPSAMLIYPAVG
FT                   TKKAAIRIKGPMDRDSKRVLKNTIRDLLLQNESFTLTAALEEHCESRTACKKLMVPHVS
FT                   FSVK"
     gtgtttatgg atatttctga gtgcagttta cctgacgcta tagattctat tgctcgaatt        60
     cccgagggta gccgcgtgag tgttatcggt ccccctggca gcggtaagac aagtcttctc       120
     ctgagtcttc ttgaaaagta ttccgaaagt tttgaacccg aggaggttct tgtccttgcc       180
     cctgggcgcc tcttggccaa tcgtctaaac ggcatagccc ttccggcact tctgaaagag       240
     aaaaaggttc gttcagggcg tcttgttgtt acaccggcaa gttttgcatt tcgcattgtt       300
     cagaacagta tgaagggtga acgacccacc cttctctcgg gagctgatga agatcaggta       360
     atagctgaaa cgattgcaca aaattgtgaa ttattcaaaa gttcatatgc tcgtagcccg       420
     aatttcagga gtcggatgcg attctttatc gaagacctct cgagacacgg gattgaccct       480
     gcccatctcg gcaaaattga cagatggaag acgtacgctg ccctaataga aaaatatcgc       540
     ctggcaagga cttctaacaa tgcatttact gccgtagaaa taattgagcg cgccgcacag       600
     cttgcctcaa cgggctactt accatacaga gtcattatgg ttgacgaggc gcaagagctt       660
     gccgcagaac atatgcgcct tttttcggca ctcgcgagac gtaacattac cgtaatcctg       720
     ttcggtgatc ccgataaagc tgttgcaaga agcgcctccc cctcaatttt tcttgacttt       780
     tcagagaaat tgtttgtttt aaaaacagta tttcgcacac ccagaaatct gcatctgctg       840
     tcacagaaga tctgtcaagg gataggtgtt acaggtagtg tcttggcaca tagacagtct       900
     ttcaattcct caattcttga aggtcgtgta gaaactgtca tttcttcttc tcgcgcgact       960
     tctatggcag atatcgcgcg atggtttaga gagaaacatt tgctggaagg tattgattgg      1020
     gaagacatgg ctctgattat ttttcagagg agctctgccg aggtctactc gcattttctt      1080
     gagcgtttcg gcgttccggt ccagatcttg ggtggtggtt tgaatctttc tgaaaagcct      1140
     attgctggcg caattttgaa tgcaatagag cttgcctgct ttccagacat tcttaccggt      1200
     aagacccttg tcaaactact gctatcgcct ataggtggat ttgatgtatt tctgatgcgt      1260
     aaattgacaa ttgagctaaa gagaattgca ccaaagaata ttcaagtttt gaatgagaga      1320
     ttactttggg catttcatgc ttaccgtaag ctacagaccc aagacacaga tgaggtttac      1380
     agagtttttc tggccagcag gatagggagg agtttaaaaa aaatatttga atgcttgata      1440
     agcctcgaac gtctgtatag ggaagataat gtcagtcttc ccgtacttat atggcatgta      1500
     tacagttttc tcaatttaaa atcggctgtg tcaaaagagc cctggcaaac ttcaaaagtt      1560
     tcacatcgtg ttctagaaga agttatagca ctacaaaagc tcgccgatgc ggtcagcaaa      1620
     aaagaccctc tgtgttctgc cgggcttatt ctgcaaaaaa taattaacgc ggaagtgccg      1680
     gttgacaact tgtccatcag ggaaaaacgg ggttgcgtga ccatcctgac cccggcatcc      1740
     agtgttggat atgaatacag ggcagttgta ataactgata tccagggttc acataaaatg      1800
     gattccacac agcttgatcc agagctagcc ctggcagata taaacaacat tccgttttcc      1860
     agatatttgg aaagtaaatt ggcgggacgt aggcataatt tgcttagaac tctttaccag      1920
     gctgtaacac ggtcaacatc ggatttattg gtttctgtga tcgacagtgc tgagacttcg      1980
     ccatcctggc tgttttatgc ttttttttct gattatccat cctgcgaatt gtcatcttta      2040
     cccctcacac tcagaggtat tgtgacacag ctcaggcttg atttagagcg agatccgggt      2100
     aatactgagg ctgcatctgc acttaggtta cttgcaaaag aaggtattag tcaggcagat      2160
     ccacagaatt ggtatggata tttgtcgaga acagagaata agtcgtatgt tatggacagt      2220
     ataaaaccat cggccctcga taaatttcac acttgcccat tgggttggtt tacagatcaa      2280
     cttgattgca atcgatatcc cggtaacgca acagagattg gcacaataat tcatagatgt      2340
     atgcaggagc ttacatgtga taacaggcag ccaaacctga atgagttttt agattacgcg      2400
     tacgcaaaac ttcgtgaagc ggattttgag tcgcgctggg ttcttgagcg agaaaaaaag      2460
     cgcctggttg gcattattag gaaattggtt gattacctaa tagattttga tgcacatggc      2520
     ggaacgctat tagcatccga aaagagtttt agttttgatc taaatgtgtt caaagacagg      2580
     tcgattatga tatcggggca aattgacaga ctcgagcgtc tttccagtgg cgagatcaga      2640
     attgttgatc tcaaaactgg tagtagttta ttgagtaaaa acgatgcgga gagtaattta      2700
     caactttctg cttatcaact tgctgttgag catctggata ttgtttacga gactttaccg      2760
     tcagctatgc tgatttatcc ggcggttggc acgaaaaaag ccgctattcg gataaagggc      2820
     ccaatggaca gagattcaaa aagggttctg aaaaatacta ttcgtgatct tcttttgcaa      2880
     aacgaaagtt tcacgctaac agctgccctt gaggagcatt gtgaatctag gactgcatgc      2940
     aaaaaactta tggtcccaca cgttagtttt tcagtgaaat ga                         2982
//

If you have problems or comments...

PBIL Back to PBIL home page