(data stored in ACNUC30630 zone)

EMBL: BX251410.PE227

BX251410.PE227       Location/Qualifiers
FT   CDS_pept        267878..270799
FT                   /transl_table=11
FT                   /locus_tag="TW243"
FT                   /product="putative ATP-dependent DNA helicase subunit"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ATP-dependent DNA helicase SCO5184 or 2SC3B6.08
FT                   SWALL:Q9FCK4 (EMBL:AL390968) (1222 aa) fasta scores: E():
FT                   9.9e-16, 26.61% id in 1161 aa, and to Escherichia coli DNA
FT                   helicase II UvrB or MutU or PdeB or Rad or Recl or b3813
FT                   SWALL:UVRD_ECOLI (SWALL:P03018) (720 aa) fasta scores: E():
FT                   2.8e-09, 24.25% id in 800 aa"
FT                   /protein_id="CAD66919.1"
FT                   /translation="MNMSLRDSRHMCSILNLHAPTEEQRAIIESPLENALVIAGAGSGK
FT                   TETLVLRLLWLIASGKLKPESIMGLTFTRKAAGELASRLQKSLAILNSYTGDVLSPEID
FT                   VLTYNSFANSIYQDNALLLDHPVPYTAIEDSEAQLIARRLLVEHGLDEDEPSETIDNLA
FT                   SSLIKLDDAIVDNLLDLGELNQFASEFIEFVGAFDAPVAKSDVFRAKRLIALSKLIPAL
FT                   KDEKKLRGRISYSEQVAFALEVCRQTHVLAEFQEKIAYVVLDEYQDTSPIQVEFLKTIF
FT                   GNRCRVLAVGDPRQAIFGFRGASVANIANFARDFVSNKQYELSISWRNDKNILDLANHI
FT                   SPKIRPLHPRPEANDGSTSLEVYTDPEQEVHEGALWLNSVVEKGTAAVLTRTRSRLISV
FT                   SRVLDEIGVSYTRADVNIFYEPGVVDILSCMRIISGVNENLSFLRLITGPRWQVGISDL
FT                   HALRGYIAVGKKNLDRISLLEAVNRINIQKTPMSCEGKKRLEDFLEFFRKIKGLSFLSP
FT                   LELAYLIEESLNLDIEVQMSHRGRENLDALYELIASFRGDNLSEMLAWFDSLEEEDAFR
FT                   GPIKQSCPGQVELFTVHSAKGLEWDWVLLPFLDDFPAKSREKSGWLSKTGLLPFCLRLD
FT                   RESLPEFYFHKCSDSKEYRAARRQYEDDVLQHQIREERKLLYVAVTRARQGLRISASAR
FT                   QKPGQFLREISEFLQTDLPQAVHNNPKKRVGYWPLDSLGARRKRVKLAAAAVHNRSIEE
FT                   SEESLKKEPLKALIAGMLKELDISVDKPEKRISATALSKKDPNVFLLPQPPIKNAWLGV
FT                   AFHAWIENYYSTYSDMLFHENSADEYGISGPVFEQSQRFSPELDQLRHNFMQSEWSYKK
FT                   PIAVELSLEWLIGDVIVPCTIDAVFFDGDRYTILDWKSGLSSNQYRIQLSLYRLAFAEW
FT                   KGVNPDKVEAKIYFAADNRTIKVRPYTVDELGKMPGFLSDLFS"
     atgaatatgt ccctcagaga cagtcgtcat atgtgcagta ttctcaatct gcatgcgccg        60
     actgaagaac agagggcaat tattgaatct ccactggaaa atgctcttgt tattgccggc       120
     gcaggaagtg gtaaaactga aactcttgtt cttagactct tgtggcttat tgcatccggc       180
     aagctcaagc ccgagtctat tatgggctta acatttacca gaaaagccgc gggcgagttg       240
     gcatcccgcc tgcagaaatc ccttgcaata ctcaattctt atactggtga tgtattgagt       300
     ccagagattg atgttcttac ctacaattca tttgccaatt ccatatatca agataacgcc       360
     ctgttgcttg accatccggt tccctataca gcaattgagg attctgaagc ccaactaatc       420
     gcgcgcagac ttcttgtgga acatggcctt gacgaggacg agccgtcaga gacaattgac       480
     aacttggcgt caagtctcat aaaacttgat gatgccatag tggacaatct actcgatttg       540
     ggtgaattaa atcagtttgc ctcagaattt atcgagtttg taggtgcttt tgatgcaccc       600
     gttgcgaagt cagacgtatt cagggccaag aggttaattg cactttcaaa acttattcca       660
     gctttgaaag atgaaaaaaa acttcgcggc agaatcagct attccgagca ggttgcattc       720
     gcactggagg tttgtcgcca gactcatgtt ttggcggagt ttcaggagaa aatagcttac       780
     gttgtattag atgaatatca ggatacatca cccatccagg ttgagtttct gaaaactatt       840
     ttcggcaata gatgtcgtgt tcttgcagtc ggcgatccaa ggcaggcaat ttttggtttc       900
     agaggcgcaa gcgtggctaa tattgcaaac tttgcacgtg attttgtttc caacaaacag       960
     tacgaattgt ctattagttg gcgaaatgac aaaaatattt tggatttagc aaaccacatt      1020
     tctccgaaaa taagaccttt gcacccaaga ccagaagcaa atgatgggtc aacttcgctt      1080
     gaggtttaca ctgatcccga gcaagaggtg catgaaggcg ccctgtggct caattcggtt      1140
     gtggaaaaag gtacggctgc ggttcttaca cgaactagat cacgtttgat ttctgtaagc      1200
     cgtgttttgg acgagatcgg tgtttcgtac actcgtgctg atgtgaatat attttacgag      1260
     cccggagttg ttgacatctt gtcatgtatg cgaataataa gcggcgtaaa tgaaaatctt      1320
     tctttcttgc gtctcattac aggtccgcgt tggcaggtag gaataagtga tctacacgcc      1380
     ctgcggggtt atattgcggt cggtaaaaaa aacctggaca gaatatccct tttggaggcg      1440
     gtaaatcgta taaatataca aaaaacacct atgtcttgtg agggaaagaa gcgcctggaa      1500
     gattttttgg aattttttcg caaaataaaa ggtctttcat ttttatcacc ccttgagttg      1560
     gcatacctaa ttgaggagtc cctgaacctt gatatagagg ttcaaatgtc ccaccgtggt      1620
     cgcgaaaacc tagatgcact atacgaactg attgcgtcct ttaggggaga taacttaagc      1680
     gaaatgcttg cgtggttcga ttcccttgaa gaagaagatg ccttcagagg ccccataaaa      1740
     caatcctgcc ccggacaagt cgaattattc acagttcata gcgcaaaggg ccttgagtgg      1800
     gattgggttt tgcttccatt tttggacgac tttcccgcga agagcagaga gaagagtgga      1860
     tggcttagca agacaggctt attaccattt tgccttcgtc tcgacagaga gagcctcccc      1920
     gagttctatt ttcacaaatg ctctgattca aaggaataca gagctgctcg ccgacaatat      1980
     gaggatgatg ttctgcagca tcagatcagg gaagaaagga agttactcta tgttgctgta      2040
     acccgtgcac gacagggcct gcgaatctcc gcttctgcta gacaaaaacc cggtcaattt      2100
     ctacgggaga tttctgaatt tctgcaaaca gatctaccac aagctgttca taataacccg      2160
     aaaaagcgtg ttggttattg gccccttgat tcacttggcg cgcgtagaaa acgggttaaa      2220
     ctcgccgctg cagccgtaca caatagatct attgaagaaa gtgaagaatc gctcaagaaa      2280
     gagccattaa aggctttgat agctggaatg ctaaaggaat tggatataag cgtagataaa      2340
     ccggaaaaga ggatttccgc aacagcgctt tccaaaaaag atcctaatgt ttttttgtta      2400
     ccacaaccgc ctataaaaaa tgcatggctt ggagttgcat ttcatgcatg gatagaaaat      2460
     tattactcaa catattcgga tatgttattc cacgagaaca gtgccgacga atacggcatc      2520
     tcgggccctg tctttgagca atctcaacga ttttccccag agcttgacca attacgacat      2580
     aactttatgc agtccgaatg gtcttataaa aagcccattg cggttgagct tagccttgaa      2640
     tggcttattg gtgatgttat tgtgccgtgc acaatcgacg ctgttttttt tgatggcgat      2700
     agatatacaa ttctggattg gaagtcggga ctatcatcta atcagtatcg cattcagctt      2760
     tcgttgtatc ggcttgcctt tgctgaatgg aaaggtgtca accctgacaa agtggaagca      2820
     aaaatatatt ttgcggccga taatagaacc atcaaggtta ggccatacac tgttgatgag      2880
     cttggtaaga tgccgggatt tctgtctgac cttttctcat ag                         2922
//

If you have problems or comments...

PBIL Back to PBIL home page