(data stored in ACNUC30630 zone)

EMBL: BX251410.PE228

BX251410.PE228       Location/Qualifiers
FT   CDS_pept        complement(270823..271998)
FT                   /transl_table=11
FT                   /locus_tag="TW244"
FT                   /product="putative transferase"
FT                   /note="Weakly similar to Escherichia coli macrolide
FT                   2'-phosphotransferase I MphA SWALL:Q47396 (EMBL:D16251)
FT                   (301 aa) fasta scores: E(): 1.4e-07, 26.1% id in 226 aa"
FT                   /protein_id="CAD66920.1"
FT                   /translation="MIALSPMSMAAVAVATLPNLNVLQVARGTSDSHHVDSILRCDDNR
FT                   WMLIRVPLSQNAKDKMARLVKNLRALSKGVRARLPFSIPNVLAYQPVKLSSGMNMTLIM
FT                   DHPQGYALRDIKPGEGAATSIGWAIAAIHNLPSGLLISAGYTHKTAQDCRYEVIDFVDK
FT                   ANATNMLPGSLKEKWETLVEDEDLWKFQTTVVKKNFSMDSFRFQDNQEGESSVCAILEW
FT                   EDASIDDPAYDLHWLNQLSHESAESILKAYEAFSTTTHDRGCLERAKLYAELDIARILI
FT                   DGVREEKHELIDMAKRLLLELDRTSAQEDTPKQAIHKAEGLLENAQNLSFEQQRSYEIQ
FT                   SDDVNAYSDEETYKSDQVSDSGISENLRNIEEFLGSAKTNTEEENSEAKNE"
     atgattgcgc tctcaccaat gtcaatggcc gctgtggctg ttgcgacttt accaaacctg        60
     aatgtactac aggttgccag gggcacctct gattcacacc acgtagactc catactacgt       120
     tgtgatgata atcgctggat gttaataagg gtgccactct cgcagaatgc gaaagataaa       180
     atggccagac ttgtgaaaaa tttgagagca cttagtaagg gtgtcagagc gcgcttgcca       240
     ttttcgatac cgaatgttct ggcctatcag cctgtcaaac tgtcttcggg gatgaatatg       300
     actctcatta tggatcaccc acaaggctat gcattgagag atataaagcc tggtgaaggt       360
     gctgcgactt cgattggctg ggcaatagca gcgattcata atctgccgag cggtcttcta       420
     atatctgctg ggtacacaca caaaacagct caggattgcc gttacgaagt tatagatttt       480
     gttgataagg caaatgcaac gaatatgttg ccagggtccc tcaaagaaaa atgggagacc       540
     ctggtagaag atgaagacct gtggaaattt caaactacag tcgttaaaaa aaatttctcg       600
     atggattcat ttcgctttca agataatcag gagggcgaaa gctcggtatg cgcaatcctg       660
     gaatgggaag atgcatctat tgatgaccct gcctatgatt tgcattggct taatcaactg       720
     tctcatgaaa gtgcagaaag catactaaag gcatatgaag cctttagtac aaccactcat       780
     gatagaggct gcctggagcg tgcaaagctg tatgcagagc ttgatatagc acgcattcta       840
     atcgatggag ttagagaaga aaagcatgaa ctcattgata tggcaaagcg tcttctcttg       900
     gaattggatc gcacaagtgc gcaagaagat actcctaaac aagccataca caaggctgaa       960
     ggtctgcttg agaatgcgca gaatctgtca tttgaacaac aaaggtcata tgaaatacag      1020
     tctgatgacg taaatgcata ttctgacgaa gagacataca aaagcgatca ggtgtcagat      1080
     agtgggatat ctgagaatct tcggaatatt gaagaattcc ttggcagtgc aaaaacaaac      1140
     actgaagagg aaaatagtga agcaaaaaat gaatag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page