(data stored in ACNUC30630 zone)

EMBL: BX251410.PE229

BX251410.PE229       Location/Qualifiers
FT   CDS_pept        272079..273836
FT                   /transl_table=11
FT                   /locus_tag="TW245"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ATP-dependent DNA helicase SCO5188 or 2SC3B6.12
FT                   SWALL:Q9FCK0 (EMBL:AL390968) (785 aa) fasta scores: E():
FT                   2.7e-40, 35.14% id in 606 aa, and to Escherichia coli DNA
FT                   helicase II UvrD or MutU or PdeB or Rad or Recl or b3813
FT                   SWALL:UVRD_ECOLI (SWALL:P03018) (720 aa) fasta scores: E():
FT                   1.5e-19, 25.47% id in 636 aa"
FT                   /protein_id="CAD66921.1"
FT                   /translation="MTIDVFSGLSDQQCDAVRTLRGPVKIIAGAGSGKTLTITRRIVNG
FT                   IISNEYDSGHVMALSFTRRASMQLRSRLVEHGVKGVYSGTFHSAALSQLRFFWETFHGK
FT                   PPRQIIRDKVNLLRDAARGINFSFSDESLCQVASEIEWAKQNGYDLSGYDKCNHRISGM
FT                   SASQARTLMLAYEDVKNNRRLIDFEDILSLTVGMLSVQPRAVARVRDRFRVFLIDEFQD
FT                   VSPLQFELLRIWLGRRRDICVVGDPNQCIYSFAGAKRDYLVKFADYFPGAREVFLSRNY
FT                   RSRPEIVCLSRHIIDSHSPDIGLYQPTEGISRNYADTKTATPAQDMRVNAGNRAKCHCT
FT                   APPGTKGAVRCGNSDLGYRETPIRWHTFENQIQEMHFIAQSLKNISQSCAVLYRTAIQG
FT                   ERLAKYLHTSGIIYRSQESRLFHETDVAQIACKRVIEKTIECNVRVVDLVDSVVSGIFP
FT                   RKPDALTGEYDGWVALQALRLCARRFNGNASSFATYLLEMQRHRREPEMPFATLATLHS
FT                   TKGLEWDTVYIIGVNEGLIPHHTGDEDEEKRLFYVGVTRARKNIVFSSTRTPSRYLTEL
FT                   CLSPISAKE"
     ttgacaattg atgttttttc gggacttagc gaccaacagt gtgatgctgt ccgtaccctg        60
     agggggcctg taaaaataat tgccggcgcc ggaagtggca aaacactgac aattacaaga       120
     agaatagtca atggcattat ctccaatgag tatgattccg ggcatgttat ggctttgagt       180
     ttcactcgcc gcgcgagcat gcaactcagg agtcgccttg tagagcacgg cgttaaaggg       240
     gtttattcag gcacttttca cagcgcggca ctttcacagc tcaggttttt ttgggagacc       300
     tttcacggaa agcctccaag acagataatt cgcgataagg tgaatttact gcgggacgca       360
     gcacgaggaa taaactttag cttttcggat gagtcattgt gtcaggttgc ttcggaaata       420
     gaatgggcaa aacaaaacgg ctacgacttg agtggatacg ataagtgcaa tcacagaatt       480
     tctggtatga gtgccagtca ggcgcgcact ctcatgcttg cttatgagga tgtaaagaac       540
     aatagaaggc taatcgactt tgaggatata ctttcgctca cagttggcat gctgtctgtt       600
     cagccgagag ccgttgctcg tgtgcgagac aggtttaggg tatttttgat tgatgaattt       660
     caggatgtgt cacccctaca atttgagctc ctgcgaattt ggcttgggcg caggcgtgat       720
     atttgtgttg tcggagatcc taatcagtgt atatattcgt ttgcaggggc aaaaagggat       780
     tatcttgtca aatttgccga ctattttccg ggcgcgcgag aggtttttct tagccgtaat       840
     tacagatctc gtccggaaat agtgtgttta tctaggcaca ttattgactc tcactcaccg       900
     gatatcggac tgtaccagcc caccgagggt atctctcgca attatgccga tacaaaaacg       960
     gctactcctg ctcaggatat gcgggtaaat gccggaaata gagcgaaatg tcattgcacg      1020
     gcaccccctg gcaccaaagg cgcggtgaga tgtggtaatt ccgatttggg ttatcgtgaa      1080
     acccctattc gttggcatac ttttgaaaac cagattcagg aaatgcattt tattgctcag      1140
     agtctgaaga atatttcgca gagctgtgct gtgctctaca gaacggcaat tcagggcgag      1200
     cggttggcaa aatatttaca cacatcagga ataatttata gaagccaaga aagccggctg      1260
     tttcatgaaa ctgatgttgc acagattgcc tgcaagcggg ttattgaaaa gacgattgaa      1320
     tgtaacgtca gggtggttga tttggttgat agtgttgtgt ctggaatatt cccgcgcaag      1380
     ccagatgcac taacaggcga gtacgatggt tgggttgccc ttcaggcatt gcgattgtgc      1440
     gctaggcgtt tcaatggcaa tgcttcgtct tttgccacat atttgctcga aatgcagcgg      1500
     cataggcgtg agcctgaaat gcccttcgca accctcgcaa ccttacattc aacaaagggt      1560
     cttgagtggg acactgtata cataatcggt gtcaacgaag gtctaattcc acatcacacc      1620
     ggtgacgaag atgaggaaaa acgcctattt tatgtgggcg ttacccgcgc gagaaaaaac      1680
     attgtattca gcagcacacg cactcccagt aggtatttaa ctgaattgtg cttatcacct      1740
     atatctgcca aggaatag                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page