(data stored in ACNUC30630 zone)

EMBL: BX251410.PE23

BX251410.PE23        Location/Qualifiers
FT   CDS_pept        23168..23563
FT                   /transl_table=11
FT                   /locus_tag="TW023"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66715.1"
FT                   /translation="MWRKLASVPALIIYLAFVPVLTVAAEIYVLTGYSLPWLGIPAFAL
FT                   VIITINSGLLPNRDVSPSRLARLAVYLALAALIVFVVVCMTIYFTVGLSRLARFDVLAP
FT                   FVLGYLLASALSVELCYKLKAKKSGKV"
     ttgtggcgta agctagcctc agtccctgca ctaattattt atctggcatt tgtgccggtt        60
     ttgacagtag ccgcggagat ttatgttctc acgggttata gcctgccgtg gcttggcatt       120
     cccgcctttg ctctcgttat tatcacaatt aactcaggtt tattgcccaa tcgtgatgtg       180
     tctccaagcc gattggccag gcttgcagtc tatctcgctc tagctgctct aattgtgttt       240
     gtcgtcgttt gtatgactat ctattttacc gtcggcttat ctcgattagc ccgttttgat       300
     gtcttagctc cttttgtgct gggttatctt ctggcaagtg cgttgtcagt tgagctatgt       360
     tataagttga aagcgaagaa atcaggcaag gtataa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page