(data stored in ACNUC30630 zone)

EMBL: BX251410.PE232

BX251410.PE232       Location/Qualifiers
FT   CDS_pept        276892..277263
FT                   /transl_table=11
FT                   /locus_tag="TW248"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO1749 or 2SCI34.02 SWALL:Q9EWX7 (EMBL:AL445403)
FT                   (146 aa) fasta scores: E(): 3.5e-07, 35.33% id in 133 aa"
FT                   /db_xref="GOA:Q83I43"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I43"
FT                   /protein_id="CAD66924.1"
FT                   /translation="MAGGLKKAMVYLGLAEDNQELHSAPSGMSHLRRVPHPKQQMSEIF
FT                   TFHPKKYSEVSGIVERFRQNIPVIIDMSQLSDTDARRMIDFASGLSQGLVGKIERVVGK
FT                   VFLLSPEHISISTESKKEE"
     atggcgggtg gtttgaaaaa ggcaatggtt tatcttggtt tggctgaaga taatcaagag        60
     ctgcacagcg cgcctagcgg tatgtcgcat ctgaggcgcg ttcctcaccc caagcagcaa       120
     atgagcgaga tattcacttt tcatccgaag aaatatagtg aagtttcggg cattgttgag       180
     cgttttcgtc agaacatacc cgtgataatc gatatgtctc agctatctga taccgatgca       240
     cgcaggatga ttgattttgc cagtggactt tcgcagggcc ttgtcggaaa gattgagcgc       300
     gtagttggta aggtttttct cctatctccg gagcatattt ccataagcac cgaatccaag       360
     aaggaggagt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page