(data stored in ACNUC30630 zone)

EMBL: BX251410.PE233

BX251410.PE233       Location/Qualifiers
FT   CDS_pept        277348..277875
FT                   /transl_table=11
FT                   /locus_tag="TW249"
FT                   /product="putative cell division protein"
FT                   /note="Similar to Bacillus subtilis minicell-associated
FT                   protein DivIVA SWALL:P71021 (EMBL:U60901) (164 aa) fasta
FT                   scores: E(): 0.031, 27.32% id in 161 aa"
FT                   /protein_id="CAD66925.1"
FT                   /translation="MVLSPSDIVNKRFGVTKFREGYDQDEVDDYLDEVAVDLRHLLERN
FT                   DELSSELESARGQIQALKDELAEASRGASGGSFGDQAAEILALAKRARDEYIQEGVKRR
FT                   DAIVAEARESAERAARTSESELTRRVEALKLEIPALEKRVLDLRAFESDYRDRLRAFLQ
FT                   SGLRDLEPKNPS"
     atggttttgt ctcccagcga catcgtgaac aagaggttcg gggtgaccaa gttcagggag        60
     ggatatgacc aggatgaggt tgatgattat ctcgatgagg ttgctgtcga tcttcgtcat       120
     ttgcttgaga gaaatgacga actatcgtct gagctggaga gtgccagggg gcaaatccaa       180
     gccctaaagg atgagctggc cgaggcttct cgcggtgcct ctggtggctc gtttggtgat       240
     caggctgcag agattcttgc tctcgcaaag cgtgcccgtg atgagtatat acaggagggt       300
     gttaagaggc gggatgctat tgttgccgag gcccgtgaat ccgctgaacg tgctgctcgc       360
     acatctgaga gtgaactcac caggcgggtt gaggctctca aactcgagat acctgccctc       420
     gagaagcgtg ttcttgattt gcgtgctttc gagagtgact atagggacag gttgcgtgct       480
     tttttgcaga gcgggctgcg tgacctagag cctaagaacc cctcttga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page