(data stored in ACNUC30630 zone)

EMBL: BX251410.PE239

BX251410.PE239       Location/Qualifiers
FT   CDS_pept        285371..286027
FT                   /transl_table=11
FT                   /locus_tag="TW255"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   27.0 kDa protein Rv2182c or mtv021.15c or mt2237
FT                   SWALL:O53516 (EMBL:AL021957) (247 aa) fasta scores: E():
FT                   6.9e-07, 26.92% id in 208 aa"
FT                   /protein_id="CAD66931.1"
FT                   /translation="MFRYTLRGNVPLRGPVIIVANHNSELDPILFAIAIWRMGRKPYFM
FT                   AKRQLFSVPALGACLRFLRQIPVTRPSDTPCGDMTENTHAPSLLTAIRRLRAGGVIVLY
FT                   PEGSVTRHPELWLDSFNPGFVHLASLTGTPIICAAQWGAQKTLPYGKKLPKFGLRNAYS
FT                   VVFCAPVHIPRKRLSDEEIKRFSNLMKEKINTALAAIRLSDETGFMRHERGWVAQ"
     ttgtttcgtt acacactgcg gggtaatgtt ccgctaaggg gtcctgttat catcgttgca        60
     aatcacaata gtgaactaga tccgatttta tttgcgatag ctatttggcg catgggtcga       120
     aagccatatt ttatggcgaa gcgtcagtta ttttccgtgc ctgccttagg tgcatgcctg       180
     aggttcttgc ggcagattcc tgttacccga ccctctgata cgccatgtgg tgatatgaca       240
     gaaaatacac acgcgccttc actcttgaca gctatcaggc gccttcgtgc cgggggagtt       300
     attgtgcttt atcccgaagg gtctgttaca cggcatcccg agctgtggct tgacagtttc       360
     aatccgggat ttgttcattt ggcaagccta acaggcacac ccattatttg tgcggcccag       420
     tggggtgcac agaaaactct tccttatgga aaaaagttac caaaatttgg gctgcgcaat       480
     gcgtacagtg ttgtattttg tgccccggtg catattccga gaaaaaggct gtcagatgag       540
     gagattaagc gcttcagtaa cctgatgaag gaaaaaatta atacagccct tgcagctatc       600
     aggttatccg atgagacagg cttcatgcga catgaaagag ggtgggttgc gcaataa          657
//

If you have problems or comments...

PBIL Back to PBIL home page