(data stored in ACNUC30630 zone)

EMBL: BX251410.PE24

BX251410.PE24        Location/Qualifiers
FT   CDS_pept        23661..23798
FT                   /transl_table=11
FT                   /locus_tag="TW024"
FT                   /product="putative integral membrane protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66716.1"
FT                   /translation="MAYELHNLLHCAVPYDLLVFSRYIAFTVVAVSPIFWLIPGNYALL
FT                   "
     atggcgtatg agctgcataa cctgttacat tgcgctgtgc catatgacct tcttgtgttt        60
     agccgttata tcgcttttac cgtggtggcc gtaagtccca tattctggct tatacccggc       120
     aattatgctt tactatga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page