(data stored in ACNUC30630 zone)

EMBL: BX251410.PE242

BX251410.PE242       Location/Qualifiers
FT   CDS_pept        complement(288036..288500)
FT                   /transl_table=11
FT                   /locus_tag="TW258"
FT                   /product="conserved hypothetical lipoprotein"
FT                   /note="Weakly similar to Streptomyces coelicolor
FT                   hypothetical protein SCO3628 or SCH10.06c SWALL:Q9X8P5
FT                   (EMBL:AL049754) (163 aa) fasta scores: E(): 3.8e-07, 32.79%
FT                   id in 125 aa"
FT                   /protein_id="CAD66934.1"
FT                   /translation="MGVSCKTVCAFIVSSALFGCSTAIVLEPAQSANNPNCAAVTVRLP
FT                   QVLGNLVSRKTTAQATAAWGEPLGAVLRCGLPVQKPTTELCVSVNNVDWVINDKFNTNI
FT                   HGVKFNVRAVTYGRSPAAEVFLDNFKISPATALATLGLAVNYLPKVASCS"
     atgggagttt cctgcaaaac cgtgtgtgcc tttattgtta gctctgcgct ttttggctgc        60
     agcacggcta ttgtgcttga acccgcacaa agtgcgaata acccgaattg tgcagctgtt       120
     acagtaagac ttccgcaagt actgggaaat ctggtaagca gaaaaacaac tgcccaggca       180
     acagctgcat ggggagaacc attgggagcc gtgttgcgtt gcggacttcc tgtgcaaaag       240
     ccgacaactg aattgtgtgt cagtgtaaac aatgttgact gggtaataaa tgacaaattt       300
     aatacaaata ttcatggggt aaagttcaat gtaagagccg ttacctacgg gcgatcgccg       360
     gcagctgagg tgtttttgga caattttaaa atatcaccag caacagcact ggcaacactt       420
     gggttggcgg taaattacct gccaaaagtg gcttcatgca gttga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page