(data stored in ACNUC30630 zone)

EMBL: BX251410.PE243

BX251410.PE243       Location/Qualifiers
FT   CDS_pept        complement(288527..289912)
FT                   /transl_table=11
FT                   /locus_tag="TW259"
FT                   /product="putative lipoamide acyltransferase"
FT                   /note="Similar to Bacillus subtilis lipoamide
FT                   acyltransferase component of branched-chain alpha-keto acid
FT                   dehydrogenase complex BfmB SWALL:ODB2_BACSU (SWALL:P37942)
FT                   (424 aa) fasta scores: E(): 1.6e-33, 34.64% id in 459 aa,
FT                   and to Streptomyces seoulensis dihydrolipoamide
FT                   acetyltransferase PdhB SWALL:Q9Z6I4 (EMBL:AF047034) (612
FT                   aa) fasta scores: E(): 1.3e-48, 41.3% id in 477 aa"
FT                   /protein_id="CAD66935.1"
FT                   /translation="MSEDFILPALGESVSECVITRWLKEAGDRVEVDEPLVEVSTDKVD
FT                   TELPSTLTGILEEILVQRDETAKPGQILARIAVDKDETKSNFDHGVKQSDVITGDSAGN
FT                   LLGNTRPIEDNEWPVTLHTAESKPDLSAKADHIGDEGDKQGNLYAAHNAEIPYATPIVR
FT                   QLARKLNIDLTNIVGSGVGNRILREDVLLASNRTTNTSTECAQNIPSSPEHDKSAASFD
FT                   SEVSELRGTRIKMSRLRNIIAERAVHSMQNTAQLSTVIEVDLTRIVDYRNSIKEKFKEA
FT                   EGVNLTVLPFIINATVQALRKYPVINSHIVDDQIVFPDYENISLAVDTERGLLTPVIKN
FT                   AGDMTVAQFAKSVFDLARRARNNKLSPDELTGGTFTVTNTGSRGALFDTPVVFLPQLAI
FT                   LGIGAIARRPVIVLDAQGNECISIRSVAFFALSYDHRVIDGADAARFLGYIKSLLETGN
FT                   CTV"
     atgagtgagg actttatcct gcccgcattg ggtgaaagcg taagtgagtg cgtcataact        60
     cgctggctca aagaagctgg ggatcgggtt gaagttgatg aaccactggt tgaagtctca       120
     acggataaag ttgataccga gcttccgtcc actttaactg ggatattgga agaaatactt       180
     gttcagcgcg atgaaacagc aaaacctggg cagattctcg ctaggatagc agtcgataaa       240
     gatgagacga aaagcaattt tgaccacggg gtaaaacaat cagatgtaat aacaggggat       300
     tccgccggta acctgttggg taatactcgt ccaatcgaag ataatgaatg gccagtcaca       360
     ctgcataccg cagagagcaa accggatcta tcagcaaaag cagatcatat tggagatgaa       420
     ggcgacaagc aaggcaattt gtatgctgcg cataatgcag aaataccgta cgcaacaccg       480
     attgttagac agcttgcaag aaaactgaat attgatctaa ctaacatagt cgggagcgga       540
     gtgggcaaca gaatcctaag ggaggatgta ttgttggcga gtaaccgcac aacaaatacc       600
     tcaaccgaat gtgctcaaaa catcccatca agtccagaac atgacaaaag tgccgcaagc       660
     tttgacagcg aagtatcaga actccgtggg acgcggatta agatgtctcg cctgcgcaac       720
     ataatagctg agagggctgt tcattcaatg cagaacaccg cacagcttag cactgtaatt       780
     gaggtagatc taacaaggat agttgactat cgcaatagca taaaagaaaa attcaaagaa       840
     gcggagggtg tgaatctaac cgtcctaccg tttataatca acgccacagt tcaagcactt       900
     agaaaatatc cagttattaa ttcccatatt gtggatgatc aaatagtttt tccggattat       960
     gaaaatattt cacttgctgt tgacaccgaa agagggttgc tgacacccgt aataaaaaac      1020
     gctggagata tgacggtggc gcaatttgca aaaagtgttt ttgatctggc gcgaagggca      1080
     cgtaacaaca aactatctcc agatgaactt accggtggaa catttacagt cacgaatacc      1140
     ggttcccgag gtgctctatt tgatacgccg gttgtatttc ttccgcaact cgcgattttg      1200
     ggaattggtg ctattgcaag gcgtccggta attgtgttag acgcgcaagg aaacgagtgt      1260
     atctcgataa gatccgtggc gttttttgcc ctatcgtacg accatagggt tattgatggc      1320
     gcggatgctg ctaggttttt aggatacata aaatccctgc ttgaaacggg aaattgtaca      1380
     gtttag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page