(data stored in ACNUC30630 zone)

EMBL: BX251410.PE245

BX251410.PE245       Location/Qualifiers
FT   CDS_pept        complement(291425..292933)
FT                   /transl_table=11
FT                   /locus_tag="TW261"
FT                   /product="putative aminopeptidase"
FT                   /note="Similar to Rickettsia prowazekii cytosol
FT                   aminopeptidase PepA or Rp142 SWALL:AMPA_RICPR
FT                   (SWALL:P27888) (500 aa) fasta scores: E(): 5.4e-43, 35.72%
FT                   id in 459 aa"
FT                   /db_xref="GOA:Q83I32"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I32"
FT                   /protein_id="CAD66937.1"
FT                   /translation="MSDYTNTVTVEITSDDSLVADVIVVPVASGAVPRLPEDSKFRAYE
FT                   DILQKLGVTGSKDELTRIPLDGSKHVVLAFIGVGKAFSATELMFAAGSAVRQIGARCIQ
FT                   IDFSVTQKDKLSAIVEGAFLGAYRFDKYRSKKSECPEVIRVSHNINGITDSECRQIIAR
FT                   AKVIAGSVGLAKDLVNTTGDDLYPAQFASFVAKDLEGIDHISVESWDEKRLQEKSCGGI
FT                   LGVGRGSNFPPRLVKISYTPGQYKKHLSLVGKGITFDTGGLSLKPASAMLGMKYDMTGA
FT                   ANVFAVLRIVALLRLSVRVTGWLCLAENMLSGSAIRPGDILRTYSGKTVEVTNTDAEGR
FT                   LVLADGLALAGDERPDVIIDIATLTGAAKVALGESCSGLMGNNPDLLCSLEVAAKSVGE
FT                   KFLAVPIDDDALQKALKSDIADIVNVPTSNKVPGMQFGAVFLKEFETTNDSGEAIPWAH
FT                   LDVAGPANASYDTGFNSCGPTGVAVRSLVEFCRCLSSAPERKLF"
     atgagtgatt acacgaatac tgtgaccgta gagattacaa gtgacgattc acttgtggca        60
     gatgtcatcg tggttcctgt agcttctggc gcagtgccaa ggctgcccga agactctaaa       120
     tttagagcgt acgaggatat ccttcaaaag cttggtgtaa caggatccaa ggatgagctc       180
     actcgcattc cccttgacgg tagtaaacat gttgttctgg cttttatagg ggttggcaag       240
     gcattttctg cgacagaatt aatgttcgca gctggatctg cggtaaggca aattggtgcc       300
     agatgtattc agatcgactt ctctgtgacg cagaaggata agcttagtgc catcgtagaa       360
     ggtgcatttc ttggagcata cagatttgat aaatatcgca gcaagaagag cgagtgtccc       420
     gaagtaatac gtgtctctca taacataaac ggcataacgg atagtgagtg caggcagata       480
     attgcccgcg ctaaggttat tgcaggatca gttggccttg cgaaggacct tgtgaacaca       540
     accggggatg acctgtatcc tgcgcagttt gccagttttg ttgcgaagga cctggagggt       600
     attgaccaca tttctgttga atcttgggat gaaaagcgcc ttcaggaaaa gtcttgcggt       660
     ggaattcttg gtgttgggcg cgggtctaat ttcccgccgc ggcttgtgaa gatctcgtac       720
     actcccgggc aatacaagaa gcacttgagt ttggtgggta aaggaatcac tttcgacact       780
     ggtggtttgt cgctaaaacc ggcatctgca atgctcggca tgaaatacga catgaccggg       840
     gccgctaatg tatttgccgt gctcagaatt gtcgctcttc tgcgtttgtc tgtgagggtg       900
     acggggtggt tatgtcttgc ggaaaatatg ctgtcaggaa gtgctatccg ccctggggat       960
     atacttcgaa cgtacagcgg aaaaacggtc gaggtaacga atactgatgc agagggcagg      1020
     ttagttttag ccgatgggct tgcccttgct ggtgacgaaa ggccagatgt aattattgat      1080
     attgcgacat taacgggcgc agcaaaagtt gccctaggag aaagttgttc ggggcttatg      1140
     ggtaataatc ccgacctgct ttgttcgctt gaggttgcgg cgaaaagtgt tggggagaag      1200
     tttcttgctg tcccaataga tgatgatgcc ttacaaaagg cgttaaagtc tgatatcgca      1260
     gatattgtca atgtgccaac ttcaaataaa gtacctggga tgcagtttgg tgctgtcttt      1320
     ctcaaagaat ttgagacaac aaatgactcg ggcgaggcta tcccatgggc ccatctggat      1380
     gttgcaggtc cagcaaatgc atcttacgac accggattta attcttgcgg cccgactggc      1440
     gtggctgtaa ggtcccttgt tgaattttgc cgatgcctgt cttctgctcc agagcgaaag      1500
     ctgttctag                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page