(data stored in ACNUC30630 zone)

EMBL: BX251410.PE248

BX251410.PE248       Location/Qualifiers
FT   CDS_pept        297309..298694
FT                   /transl_table=11
FT                   /locus_tag="TW264"
FT                   /product="conserved hypothetical protein (possible murein
FT                   ligase)"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   43.4 kDa protein Rv3712 or mtv025.060 or mt3815
FT                   SWALL:O69679 (EMBL:AL022121) (413 aa) fasta scores: E():
FT                   1.4e-18, 31.18% id in 388 aa. Weak similarity to murein
FT                   ligases."
FT                   /protein_id="CAD66940.1"
FT                   /translation="MRGCLAIFFGRALLVALRVLRSGGSVLPGVLAEFISPGILIRLIG
FT                   NSEIIFVTGSNGKTSTTRMAVSILRAHGHEVFTNSSGANMKYGIIASLLAVPKRTRKGI
FT                   ALLEVDEGHIETLADLLKPSTALFLNLQVDQLNRFHDPGTVLVKLKNSLAFVKDVLIFN
FT                   LNEPCFSELLESSLASQKLSVYGFSSSSDILNSIPPTGLLPHLRGQFSPPGRIESLCHI
FT                   EHYSARTAHFSIQGVDRLQEIQLRTEGVHHAQNAAAAFALCMKILGDEFDPNKASSAVS
FT                   LSTPAFGRDQVISLAGQPVRILLMKNPRSMQVNLESIAAGSRVMIGIDGGTPDPSWLYD
FT                   VNLSDIKRAVVTGSMAWQVALALSYAGVVIDLVEPNLFRATNYFLRHSSSDKFQSFYNK
FT                   KSEVLRKSNFDNNQCVTATHLDADFNRDQFGAKDDSAMVMILNYEMSMRLLRHYRYLDS
FT                   SCY"
     ttgaggggtt gcctggccat cttcttcggc cgcgctcttc ttgttgcctt gcgtgttcta        60
     cgttctggcg ggtcagtctt acccggtgtt cttgctgagt ttatatcccc tgggattctc       120
     attcgtctta ttggaaactc tgaaattatt tttgtgactg ggagtaacgg gaagacctcg       180
     acaacccgga tggcagttag cattctaaga gctcatgggc acgaggtctt tacgaattct       240
     agtggtgcca atatgaaata tggcataatc gccagtttgt tggcagtgcc aaagcgcacc       300
     cgtaaaggta ttgccttgct tgaagtagat gaagggcata ttgagacgct tgcagatctc       360
     ttgaagccga gtaccgcgct tttcctaaat ctccaggtcg atcagctgaa ccgttttcat       420
     gacccaggaa cagtgctcgt caagctgaaa aatagtcttg cattcgtcaa ggatgtactt       480
     atattcaatc ttaatgaacc gtgtttttct gagctgctag aaagcagtct agcatctcag       540
     aaactgagtg tgtacggatt ctcttcaagc agtgacattc taaactcaat acctccaacc       600
     ggacttttac cgcatcttag gggtcaattt tcccctccgg gacgtataga gagcttgtgc       660
     catattgaac attattcggc ccgcacagcg cacttctcaa tacaaggtgt cgacaggcta       720
     caagaaatac aattgcgcac agaaggggtg catcatgcac agaacgctgc tgcagctttc       780
     gcgctgtgca tgaaaatttt gggcgatgaa tttgatccaa acaaagcatc ttctgcggta       840
     agtttatcaa cacctgcatt tggcagagat caggttatta gtctggccgg tcaaccggtc       900
     cggatccttc ttatgaagaa cccaaggagt atgcaggtaa atcttgaaag tattgctgca       960
     ggatctcgtg taatgatagg cattgacgga ggcacccctg atccgtcctg gctttatgat      1020
     gttaatcttt ccgatataaa acgcgctgtg gtaaccggta gtatggcatg gcaggttgcc      1080
     ctggcccttt cgtacgctgg tgttgtaatt gatttggttg aaccgaactt atttagggct      1140
     acaaattatt tccttcgcca ctcaagttcc gacaaatttc agtcttttta taacaagaaa      1200
     agcgaggtgc tacgcaaatc aaattttgac aataatcaat gtgtcaccgc tacccatttg      1260
     gatgctgatt tcaacagaga tcagtttggc gcgaaagatg attcggcaat ggttatgatc      1320
     ctcaattacg aaatgtccat gaggcttctt aggcactaca ggtacctgga tagctcgtgc      1380
     tattag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page