(data stored in ACNUC30630 zone)

EMBL: BX251410.PE249

BX251410.PE249       Location/Qualifiers
FT   CDS_pept        298685..299464
FT                   /transl_table=11
FT                   /locus_tag="TW265"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weakly similar to many eg. Staphylococcus aureus
FT                   hypothetical protein sav1891 sav1891 or sa1707 or mw1832
FT                   SWALL:Q99SZ5 (EMBL:AP003363) (243 aa) fasta scores: E():
FT                   9e-10, 25.12% id in 203 aa"
FT                   /protein_id="CAD66941.1"
FT                   /translation="MLLVDLFPHQLSIRGDRGNVTALKARAHFAGHKLEIYDLHPGNVL
FT                   PTGVSGVVIGSGPDYVLADLLGDMRRLACDLKALRDDNVPFLAISNGLRLLSEKFVSHD
FT                   DVEHTAAGVYPISCHRIRRRVGESIVKCDFGELVGFENHDIEITDNEHPLGYGLDSRGT
FT                   FSRPHGFFLGNLMACFLHGAFLPLNPIVADWFLSRMGGCATAHSVDNDCNPKQSCDNRY
FT                   CCAQPSATDLDFYSHMARRVIKKRVTRAIRYKFIPGK"
     gtgctattag ttgatttgtt tccacaccag ctgagtattc gtggtgatag gggtaatgta        60
     acagcattga aggctcgagc gcattttgct ggccacaagc ttgagatata cgatcttcac       120
     ccggggaatg ttttgccgac cggtgtatcg ggagtagtta tcggttcagg ccctgattat       180
     gttttagccg atcttctcgg tgatatgaga agacttgcct gtgacctcaa agccttgagg       240
     gatgacaatg tgccgttttt agcgatttca aatggtttac ggcttctgtc agaaaaattt       300
     gtatcacatg atgatgttga acacactgcc gcgggagttt atccaatttc ctgtcataga       360
     attcgcagac gtgttggtga gtcgattgta aaatgcgatt ttggtgaact tgttgggttt       420
     gaaaatcacg atatcgagat aactgacaat gaacatccgt taggttacgg cttggacagt       480
     aggggaactt tttctaggcc acacgggttt ttcctgggga atttgatggc atgttttttg       540
     cacggtgcct ttctgccatt gaaccccatt gttgccgatt ggtttttatc acgcatgggt       600
     ggctgtgcaa cagcacattc cgtcgataat gactgtaacc ctaaacaatc ttgtgataat       660
     cgatattgtt gcgcacaacc cagcgcaact gacttggatt tttattcaca catggcacgg       720
     agggtaatca aaaaaagggt tacccgcgcg attagataca agtttattcc aggtaaataa       780
//

If you have problems or comments...

PBIL Back to PBIL home page