(data stored in ACNUC30630 zone)

EMBL: BX251410.PE255

BX251410.PE255       Location/Qualifiers
FT   CDS_pept        complement(307631..310096)
FT                   /transl_table=11
FT                   /gene="gyrA1"
FT                   /locus_tag="TW273"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Clostridium acetobutylicum DNA gyrase
FT                   subunit A GyrA or cac0007 SWALL:GYRA_CLOAB (SWALL:P94605)
FT                   (830 aa) fasta scores: E(): 7.6e-93, 36.54% id in 799 aa"
FT                   /protein_id="CAD66947.1"
FT                   /translation="MDKDIPEIFDVISDNEKITDVDLLHQMQDSFLEYAYSVIHSRALP
FT                   DARDGLKPVQRRILYTMSRMGLSPDKAHVKCARVTGEVMGKLHPHGDAAIYDTLVRMSQ
FT                   DFTMRIPLIDGHGNFGSLNDGPAASRYTEARLSRAAVAMINDLESNVVDFVPNYDNQFT
FT                   QPEVLPALLPNLIVNGSSGIAVGMATSIPPHNLQETVRAAIYLVRNRQSSLEQIMKILP
FT                   GPDFPTGSIIVGKEAFKEIYATGKGSFKIRAKISIDYAGIGHTNLVITELPYMVGSERV
FT                   IEKIKQGVNAHRIDGILDVTDLSDRKNGLKLVIGIKPNFSPNEVMDNLYRHTPLEESFS
FT                   VNSVALIDGKPKTLGMLDMLKVFIDHRVCVITRRSKFYLATHKKRLHMIDGLLLALVDI
FT                   DKTISIIRNSEGIKEARKNLMKCLNVTRDQAEYILDIRLNMLTKLSTIKLQSEQEELRK
FT                   TTQDLEEILSDPNKIDAILIDELKKVAQRLPSPRRTILESSVKSKKQKTDYPRQVVLTT
FT                   NGFIFTIEVNNDLISELSQPETFDMTFNTHSEPLRVVKSSIVCGVRSRIGALTSAGKVI
FT                   PFTPIGLPVLDSGFVTAKSFLGLENDEEAVLLFELHQKESLAIATSSGIVKRVTPAIWP
FT                   DRTERVITLSAGDRVVGAARGVSSCGYFVFITAKGNLLHYSAGLVNPQNRPARGVAGVT
FT                   LKDDDDRVISFGYTEDVDRANVLTVSKRMTTSRLSSYQTRGRATRGVQCHKFLKGEEWL
FT                   HAAIVGENLAAIDNLGNVVAIGKSSVTAKSCAGVKQYRLPQEKSGKSKREDRLIRYLGY
FT                   PFVHGNDTY"
     ttggataagg acatccctga gatatttgat gtaatttccg ataacgagaa aataacagat        60
     gtagacctct tgcatcagat gcaagactcg tttctggaat acgcctactc tgttattcac       120
     tctcgggcat tgccagacgc gcgggatggc ttaaagcccg tacagaggcg catcttatac       180
     acaatgagtc ggatgggtct atccccagat aaagcccatg tcaagtgtgc aagggtaacc       240
     ggtgaggtta tgggaaaact tcacccccac ggagatgcag caatctacga cacgcttgtc       300
     aggatgtcac aggacttcac aatgcgaatt ccgctgattg atggacacgg caactttggc       360
     tctctgaatg atgggccggc agcgagcaga tatacagagg ccagactatc cagagcggca       420
     gttgcgatga ttaacgactt agagagcaat gttgttgatt ttgtgccaaa ttatgataac       480
     caattcacgc aacctgaagt tttaccggct ctgttaccta acttgattgt aaacggaagt       540
     agcggaatag ccgtcggaat ggcaaccagt atacccccgc ataacctaca agaaaccgtt       600
     cgagcagcta tatatcttgt tcgcaatagg cagtcaagtc tagagcaaat aatgaaaatc       660
     ctgccaggac ctgattttcc tacaggttcg ataattgttg gcaaagaagc attcaaggaa       720
     atatatgcaa cgggtaaagg ttcatttaaa atcagggcaa agatatcaat tgattacgca       780
     ggtatcggtc atacaaatct tgtcataact gaactaccct atatggttgg ctctgaaagg       840
     gttattgaaa aaataaaaca gggtgtaaat gcacacagaa tcgacggaat tctcgatgtc       900
     actgatctca gtgacagaaa aaacggctta aagcttgtta taggaattaa gccgaacttt       960
     tcgccaaatg aggtaatgga taacctctac cggcataccc ctcttgaaga atcgttcagt      1020
     gtcaacagtg ttgccctaat cgacggaaag cctaaaaccc ttggcatgct ggatatgctg      1080
     aaggttttta tagaccaccg tgtatgtgtg ataacaaggc gcagtaagtt ctatttggca      1140
     acacacaaaa agcgtcttca tatgatcgat gggcttcttt tggctctagt cgatatagat      1200
     aaaacaatct ccataatccg aaacagcgaa ggtataaaag aggctaggaa aaaccttatg      1260
     aagtgcctga atgtaacacg ggatcaggca gaatacatct tggatataag actgaatatg      1320
     ctaaccaaac tctcgactat aaaacttcag tctgagcagg aggaacttag aaaaaccacg      1380
     caagaccttg aagaaattct ttctgacccg aacaaaatcg atgcgattct tatcgatgaa      1440
     ctaaaaaagg tggcacaaag actcccatca ccccgtagaa cgattttaga gtcaagtgtc      1500
     aaaagtaaaa aacaaaagac ggattatcct cgtcaagttg ttttaaccac caatggcttt      1560
     atattcacaa ttgaggtgaa caatgatttg atatcagaat tgagccaacc cgagacgttt      1620
     gacatgacat tcaataccca cagcgaacct ttgcgtgttg tgaaatcttc cattgtttgt      1680
     ggggtgagat caagaattgg cgctctgacc agtgcgggaa aggtcatacc attcactcca      1740
     atcggtcttc cggtattgga cagtggattt gtcactgcaa agagtttcct cggacttgaa      1800
     aatgacgaag aagctgtttt gcttttcgag cttcaccaga aagaaagtct tgccattgcc      1860
     acatcaagtg gaattgtgaa gcgtgtaact ccggctatat ggccagatag aactgagcgg      1920
     gtaattactc tcagtgcggg tgacagggtt gttggggccg ctagaggtgt atccagttgt      1980
     gggtactttg ttttcataac tgcaaaaggc aatctcttgc actacagtgc aggccttgtt      2040
     aacccccaaa atcggcccgc aagaggggtt gcaggtgtaa ccctaaagga tgatgacgac      2100
     agggttatca gtttcggcta tacagaagat gtagataggg caaatgtact gactgtatca      2160
     aaaagaatga cgacatcacg ccttagctct tatcaaacaa gaggtagggc aacaagaggt      2220
     gtgcaatgtc acaagtttct aaaaggcgaa gagtggttac acgcagcaat tgttggagag      2280
     aatttggcag caatagacaa tttgggcaat gtcgtagcca ttggcaaaag cagtgtgact      2340
     gcaaaaagtt gtgcaggagt gaaacaatat cgattgccac aagagaaatc gggaaaaagt      2400
     aagcgagaag accgactaat tagatatctc ggatatcctt tcgtgcacgg caatgacacc      2460
     tattag                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page