(data stored in ACNUC30630 zone)

EMBL: BX251410.PE258

BX251410.PE258       Location/Qualifiers
FT   CDS_pept        complement(311511..311978)
FT                   /transl_table=11
FT                   /locus_tag="TW276"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Mycobacterium leprae u1764i ml1027
FT                   putative membrane protein SWALL:Q49991 (EMBL:U15181) (157
FT                   aa) fasta scores: E(): 2.4e-10, 33.76% id in 154 aa"
FT                   /protein_id="CAD66950.1"
FT                   /translation="MIMRYTERLWPGPGLFLAVALAMPISGLISMPVLQRAGVTLLWSI
FT                   PIAAGVYILLCLWLRVMSPKLEVSGGIFRAGHVEIPIKYIGTCRVINRKDVHDELGLRL
FT                   HPRSFKMTRGWVKDLVKISIIDPEDPTPYWIVSSRKPQKLVDAIKACPSDS"
     atgattatgc gttatacaga aaggctttgg ccgggtccag ggctgttttt ggcggtagca        60
     cttgcaatgc ccatttcggg tttaatttct atgccggtgt tgcagagggc aggagttacc       120
     ctattgtggt ctatcccaat tgccgcgggt gtatatatcc ttctatgtct atggctaaga       180
     gtcatgagcc cgaaactaga agtatcaggt gggatatttc gtgcaggaca tgtagaaata       240
     ccaattaaat acatcggaac ttgtcgggta ataaacagaa aagacgtgca cgacgaactc       300
     ggactaagac tgcacccacg gagttttaaa atgacacggg ggtgggtcaa agatctcgtt       360
     aagatctcta taattgaccc tgaagaccca acaccgtatt ggattgtgtc atcccgaaaa       420
     ccacaaaaac tggtagatgc gataaaagcc tgcccatcag acagctaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page