(data stored in ACNUC30630 zone)

EMBL: BX251410.PE26

BX251410.PE26        Location/Qualifiers
FT   CDS_pept        25738..26484
FT                   /transl_table=11
FT                   /locus_tag="TW026"
FT                   /product="putative protein ligase"
FT                   /note="Similar to Mycobacterium tuberculosis BirA or
FT                   Rv3279c or mtcy71.19c or mt3379 SWALL:P96884 (EMBL:Z92771)
FT                   (266 aa) fasta scores: E(): 2.8e-16, 36.11% id in 252 aa,
FT                   and to Bacillus subtilis BirA bifunctional protein
FT                   [includes: biotin operon repressor;
FT                   biotin--[acetyl-coa-carboxylase] synthetase BirA
FT                   SWALL:BIRA_BACSU (SWALL:P42975) (325 aa) fasta scores: E():
FT                   1.6e-11, 30.4% id in 250 aa"
FT                   /protein_id="CAD66718.1"
FT                   /translation="MFPCVFLDTVGSTNLYLLELLKAKDLDDFFAVFTTNQTAGRGRMA
FT                   RSWECKKGIALSVFLKHNLPGAYINWLPLVIGLAVVKAVNKMLEDATLPHRADIKWPND
FT                   VLINGKKLSGILIETPSDGNGLIVGIGLNVAVAPIATSICLRQVGLQASPKEVVSALLA
FT                   EMHTIYQQLIALAAKDISFKDSECFGEIMRLCSTINKTVRVTGTKTFVGVAQGLDSLGR
FT                   LVIRHSGDTSIVSAGDIEHLRAIDSL"
     atgttccctt gtgtatttct agacactgtt ggatcaacaa acctttacct tcttgaattg        60
     ctaaaagcca aggatctcga tgactttttt gcggttttta ccacgaatca aaccgcagga       120
     cgtggtcgca tggcaaggtc atgggaatgc aagaaaggga ttgcgttgtc tgtatttctg       180
     aagcacaatt tgccaggagc ctatattaac tggcttccac ttgttattgg acttgccgtt       240
     gtaaaagcgg ttaataaaat gttagaagat gcaacattgc cgcacagggc cgacataaaa       300
     tggccaaatg atgttctgat taatggaaaa aaactgtctg gaatactaat cgagacacct       360
     tctgatggta atggattaat cgttggtatt gggctgaatg tggctgttgc acctattgca       420
     acttctattt gcctaaggca agtaggactt caagcaagcc ccaaagaggt ggtttccgcg       480
     cttctggccg aaatgcatac aatctatcaa cagctcattg cccttgccgc caaagacata       540
     tcatttaaag attcagaatg ctttggtgaa attatgcggt tgtgctcaac gatcaacaag       600
     actgttaggg tgacgggcac caagacattt gtaggtgttg cgcaagggct tgattcgctt       660
     ggcagacttg ttattcgtca cagcggagac acttcgattg tttctgctgg ggatatcgag       720
     cacctgcgcg ctattgacag tttgtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page