(data stored in ACNUC30630 zone)

EMBL: BX251410.PE260

BX251410.PE260       Location/Qualifiers
FT   CDS_pept        312484..313059
FT                   /transl_table=11
FT                   /locus_tag="TW278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weak and partial similarity to Streptomyces
FT                   coelicolor hypothetical protein SCO5869 or SC2E9.10
FT                   SWALL:O54135 (EMBL:AL021530) (250 aa) fasta scores: E():
FT                   2.5e-19, 40% id in 175 aa"
FT                   /protein_id="CAD66952.1"
FT                   /translation="MDDRSKTGPFDESEVDSVRIFVDLGGIKVPPCERLSIRLEFDRVT
FT                   NKPVALGLDYGKSTLQVQPFAAPSNSSLWEDVRKQLRDQLLSRGAHLVETDGALGKELR
FT                   ASIPVLMAGETFSETRWARIVGVDGPRWLLRGVIVGEALTNDSAAAEIENLFRSLVVVR
FT                   GNLPMPPHEMIPLRMPLELTSGVTQSLV"
     gtggatgaca ggtcaaaaac aggtcctttt gacgaatccg aggtagattc cgttagaatc        60
     ttcgttgatc tcggcggaat taaggtacct ccgtgcgaac gcttgtctat tcggcttgag       120
     tttgacaggg ttactaacaa gcctgtcgcg ctcgggcttg attatggcaa aagcactctg       180
     caggtgcaac cattcgctgc cccgagtaac tcaagtttgt gggaggatgt tagaaaacaa       240
     cttcgagatc aattactctc acgcggtgcg catttggtcg agactgatgg cgcacttggt       300
     aaggagctgc gcgcgagtat tccagttctg atggctggtg agactttttc agagacccgt       360
     tgggcacgta tagttggtgt tgatggtccc cgctggttac tgcggggtgt tattgtcggc       420
     gaggccttga caaacgattc tgccgcagca gaaatcgaga atctattccg tagcctggtc       480
     gttgtaaggg ggaatctccc gatgcctcca catgagatga tacccttgcg tatgccgctt       540
     gaactaactt ctggtgtaac tcaaagtttg gtgtag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page