(data stored in ACNUC30630 zone)

EMBL: BX251410.PE261

BX251410.PE261       Location/Qualifiers
FT   CDS_pept        313063..313719
FT                   /transl_table=11
FT                   /locus_tag="TW279"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein sSCO5874 or SC2E9.15 SWALL:O54140 (EMBL:AL021530)
FT                   (272 aa) fasta scores: E(): 7.4e-13, 28.72% id in 188 aa"
FT                   /protein_id="CAD66953.1"
FT                   /translation="MRFSDFSELLAGISGKRSGGRTGFSNILSVLGGVRGVVESLLPPL
FT                   VYILTFSILKDLLLACIISVLLSLFIVSLRIAKRQSLVPAFSGFFGFVISVLVSLYTGR
FT                   AIDVFVIGIVWNAVLALLLLVSVLLRMPVFGFLLAGLLGDLGWRKDPNRVWAYSVITIV
FT                   FFAASLLRAVIQLPLYLSGNFELLATTKIFMGYPLLGLTVFTSWVLFRKINSKSK"
     atgcgttttt cagatttttc tgaattgctt gcaggtattt caggtaagcg ctctggcggg        60
     cgtactggtt ttagcaatat tctctcggtg ctcggtggcg tacggggtgt tgtggagtcg       120
     ctactcccac ctctggttta tattttgact ttttccattc tgaaagattt gcttcttgcc       180
     tgcattatct cggttttgct ttcattgttc attgtttccc tgcgcattgc caagcggcag       240
     tcgcttgtcc cggcattttc tggttttttt gggtttgtca tttctgttct tgtttcgtta       300
     tatacaggcc gggctattga tgtttttgtt atcggtattg tctggaatgc ggttttagcg       360
     ctactcttac tggtttccgt attgctcagg atgcctgttt ttggtttcct tcttgctggc       420
     cttttaggtg acttaggatg gaggaaggat ccgaacaggg tgtgggcata ttctgtaatt       480
     acgatagttt ttttcgctgc ctctctattg agggctgtaa ttcagctgcc cctgtatctg       540
     tcgggaaatt ttgaattact tgcaaccacg aaaattttta tgggttaccc tcttcttggg       600
     cttaccgtgt ttacctcatg ggttttgttt agaaaaatta actcgaagag taagtag          657
//

If you have problems or comments...

PBIL Back to PBIL home page