(data stored in ACNUC30630 zone)

EMBL: BX251410.PE264

BX251410.PE264       Location/Qualifiers
FT   CDS_pept        317665..318867
FT                   /transl_table=11
FT                   /locus_tag="TW282"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66956.1"
FT                   /translation="MNRRQGLRFVRSACFRLLCALSLGIVMYGAFAVLSFLTSIAIGSF
FT                   TFPSFDSSSPPGSQFFSSGPQSLFAVPMVGFLQGASLLATGFSRFAFDTAFGSMRFTVS
FT                   SLPVSTVVLLVILFISSRLLERFLPSKSLKEKILLSLSSSVVVTLLALFSLFVSDPTII
FT                   YGLFFLIFDFLALFLTDLLGRLRLRLTGFIRESLFFVTLFVVLGFVVLVVLIVPSYTEF
FT                   PFLLSALVIYSVPLSVVFAAYAGGAGFFLRVDSVYEKVSYFHTHMLFVLVLLILLFFVA
FT                   LRLAAMRKPCTKKQALSSIWHMPTAVFLLAIVLSCFTAGFSISPVVPSGSFVTVEVGMN
FT                   GVIFAVLLMAWAYLVQVFAIYAAPFVARRIPFLYRIIRLGVRKRGTVSRKQIKRVLKGL
FT                   P"
     atgaacagaa ggcaaggatt gcgctttgtg aggtctgcct gtttccgtct gttgtgcgca        60
     ttatccctcg gtattgtcat gtatggagcg tttgctgttc tatcattttt gacttcgatt       120
     gcgataggta gttttacttt cccttcattc gactcgtcat cccccccggg atcccagttt       180
     ttttcatccg gtccacagtc gctttttgca gtgcccatgg tcggcttttt gcagggtgct       240
     tctttgcttg cgacgggttt ttcaagattt gcctttgaca ccgcctttgg aagtatgcgc       300
     tttacggtct cttctcttcc tgtctccacg gttgtgttgc ttgtgatctt gtttatttcc       360
     tccagacttc ttgagcgttt tttaccgagt aagtctttga aagagaagat tctgctgtct       420
     ctgtcttcgt ctgttgttgt cacacttctg gcactttttt cactctttgt ttctgacccg       480
     acaataattt acggtttatt ttttctaatt tttgattttc ttgctttgtt tctgaccgat       540
     ctcctcggca ggttacgtct gcgccttacc ggatttattc gcgaatcatt attttttgtt       600
     accctgtttg ttgtacttgg atttgttgtt ctggtcgtgc tgattgtgcc aagttacacc       660
     gaatttcctt ttcttctttc cgccctggtt atctacagcg tccctttgtc tgtcgtgttt       720
     gctgcgtatg cgggtggcgc ggggttcttt ttgagggtcg atagcgtgta tgaaaaggta       780
     tcgtactttc atacgcatat gttattcgta ctggttctct tgattcttct gttttttgtc       840
     gccctgcgtc ttgctgccat gagaaagcca tgcacaaaaa aacaggccct ttcttcgata       900
     tggcatatgc cgacagcggt gtttttattg gccattgtgc tgtcttgttt tacggccggg       960
     ttttccattt ctcctgttgt tccttcgggt agttttgtta cagttgaagt tggtatgaac      1020
     ggcgtcattt ttgctgtgtt gttaatggcc tgggcgtacc ttgtacaggt ttttgcaatc      1080
     tatgccgctc catttgttgc caggagaatc ccatttttgt acaggataat aagacttggt      1140
     gttcggaagc gtggtaccgt gtcaagaaaa cagataaagc gagttcttaa ggggttgccg      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page