(data stored in ACNUC30630 zone)

EMBL: BX251410.PE268

BX251410.PE268       Location/Qualifiers
FT   CDS_pept        complement(321314..323884)
FT                   /transl_table=11
FT                   /locus_tag="TW286"
FT                   /product="class I tRNA synthetase (I, L, M and V)"
FT                   /note="Similar to Rickettsia conorii valyl-tRNA synthetase
FT                   ValS or rc1053 SWALL:Q92GR9 (EMBL:AE008656) (812 aa) fasta
FT                   scores: E(): 3.5e-56, 39.75% id in 825 aa, and to
FT                   Thermotoga maritima isoleucyl-tRNA synthetase IleS or
FT                   tm1361 SWALL:SYI_THEMA (SWALL:P46213) (919 aa) fasta
FT                   scores: E(): 2.7e-24, 24.4% id in 881 aa"
FT                   /db_xref="GOA:Q83I17"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I17"
FT                   /protein_id="CAD66960.1"
FT                   /translation="MNIPDKPSLEGLEEKWSKLWKSSKIYNFELEQVSAKQDVYSIDTP
FT                   PPTASGVLHIGHVFSYTHTDIIARFQRMQGKIVFYPMGWDDNGLPTERRVQNYFSVRCD
FT                   PSLPYCQNLKLAQINNDSMARSISRRNFIELCQQLSEEDERKFEELWNYLGLSVDWSQT
FT                   YRTIDDDAIHLSQHFFLENVNSGAAYQDWAPTLWDVTYRTAVAQAEIEERQITGFYYRL
FT                   AFENENATVEIETTRPELLAGCVALVAHPDDNRYKHLFGSHVITPVFDVKVPVLPHRAA
FT                   QPDKGSGIAMVCTFGDITDVQWWRDLNLQSCPIIDASGRVVPDAPDPIVSERGRRAFAT
FT                   LSGKTLSAAKKHTLEMLISEKSIIGEPRKITHPVKFFEKGDKPLEILLTRQWYIRNGYS
FT                   DNALTERLIELGKQLQWYPKTMLRRYEDWLTGLNSDWLISRQRFLGVPFPIWYQTDDRG
FT                   NAKFDDPIFPDRKDLPLDPTIAVPRGYSENQRGAPNGFVAETDVMDTWATSSLTPQLAG
FT                   KYLKNPKLFEAIFPYSLRPQGQDIIRTWLFSSIIRSEYAHATAPWKSTAISGFILDPDR
FT                   KKMSKSKGNAKTPKDILDRYGADAVRYWAACARLGVDTALDVENPTQIKIGRRLALKVL
FT                   NAARFVVHLHKNKETYSGQPDMKRCYPIDFAAISNPLDLSLLKQLDQTIEQSTNALKNF
FT                   DHSKALDTTETFFWNFCDNYVEIVKDRAYAGDESALTTLLVVTNIVIKLLAPFIPYATE
FT                   EAWSWFNETSVHTQSWPETLKLHSGDIELLKIACSFMSLVRGGKTEAKLSQKTEIAYLK
FT                   IALPNPEIIMPIMDDLRRAGKIDKCELIDGDAQILAIEYGEISR"
     atgaatattc cagataaacc gagtttagag ggccttgagg aaaaatggtc aaagctttgg        60
     aaaagctcaa agatttataa ctttgagtta gagcaggtta gtgcaaaaca agacgtatat       120
     tcgattgata caccaccccc aacggcatct ggggtgttgc acattggaca tgtatttagt       180
     tacactcaca cagacataat tgcccgattt cagcggatgc agggcaaaat tgtgttttac       240
     ccaatggggt gggatgataa cgggttgccg acagaaagac gtgtacaaaa ctacttctcg       300
     gtacgatgtg atccatcttt gccatattgc cagaatctga aacttgctca aatcaataac       360
     gattcgatgg cgcgatctat atcaagaagg aacttcattg aactatgcca acagctctcc       420
     gaagaagatg agagaaagtt tgaggagctt tggaattacc tcgggctctc ggttgactgg       480
     tcacaaacct acaggaccat agatgatgat gcaatccatc tatctcagca tttctttcta       540
     gaaaacgtta actcaggcgc tgcgtaccag gattgggcac caacattgtg ggacgtgaca       600
     tatcgcaccg ctgtggcgca ggcggaaatt gaagaaaggc aaataaccgg attttactac       660
     cgactcgctt tcgagaatga aaacgctacc gtagaaatcg aaacaacaag gcccgaatta       720
     cttgctggat gcgtcgcgct ggttgcgcat cccgatgaca acaggtacaa acatcttttt       780
     ggatcacatg tcattacacc ggtatttgac gtaaaggtac ccgtcctacc acacagagcc       840
     gcacagccgg acaagggaag tggaattgca atggtatgta catttggcga tataactgat       900
     gtccagtggt ggagagacct taacctacag agctgcccga ttatcgacgc atccggcagg       960
     gtggtgcctg atgccccaga cccaatagtg tctgaaagag gaaggcgagc ttttgctacc      1020
     ctcagtggaa aaacgctaag tgccgcaaag aaacataccc ttgaaatgct tatttctgaa      1080
     aagtcaatta tcggtgagcc gagaaaaata acccaccctg taaagttctt cgagaaaggt      1140
     gacaaaccgc tcgagatact gctaacaaga caatggtaca tccggaatgg ctacagcgat      1200
     aatgccttga ctgaaagatt aattgagctt ggcaaacaac ttcagtggta tccaaaaaca      1260
     atgcttagac gctatgaaga ctggctaacc ggattgaaca gtgactggct aatctcgaga      1320
     caaaggtttc taggggtgcc atttccgatc tggtatcaaa cagatgaccg tgggaatgcc      1380
     aaatttgatg atcctatctt tccggataga aaagaccttc cactcgatcc gacaattgcg      1440
     gtaccaagag gatactctga aaatcaacga ggggcaccca atggttttgt tgccgaaacc      1500
     gatgttatgg atacgtgggc aacatcttcc cttacaccgc agcttgccgg aaagtaccta      1560
     aaaaatccga agctatttga ggcaattttc ccgtattcac tcaggccaca ggggcaagat      1620
     ataatcagga cttggctctt ctcaagcatt attagaagtg agtatgccca tgctactgcg      1680
     ccctggaaga gtaccgctat ttccggattt attcttgacc cagacagaaa gaaaatgtca      1740
     aagtcaaaag gtaatgcaaa gactccgaag gatatactcg accgttatgg tgcggatgcg      1800
     gtcaggtatt gggcagcctg cgctagactc ggggttgata cggctcttga tgttgaaaac      1860
     ccaacacaga taaaaatagg tcgtcgactc gccctcaagg tgctaaacgc tgcgcgattt      1920
     gttgtgcatc tgcataaaaa taaagaaacc tattcaggac aacccgatat gaagcgatgt      1980
     tacccaattg attttgcagc aatttcgaac cccttggatc tcagtctttt gaagcaatta      2040
     gatcagacta ttgagcaatc tacaaacgcc ctcaaaaatt ttgatcactc aaaagcgctt      2100
     gacactacag aaaccttctt ttggaacttc tgtgataatt acgtggaaat tgtaaaagac      2160
     cgggcatacg ccggtgatga aagtgccctt acaacacttc tggtagtgac gaatattgtg      2220
     ataaaacttc tcgcgccgtt cataccatac gcaacggaag aagcatggtc gtggtttaac      2280
     gaaacctctg tgcatacgca gagctggcca gaaacactga aactccattc aggggatatt      2340
     gagctgttaa aaattgcatg ctcttttatg tctcttgtga gaggcggcaa aacggaagca      2400
     aaactgtcgc aaaaaacaga aattgcttac ctgaaaatcg cattacccaa tccggaaata      2460
     attatgccaa taatggatga cttgcggaga gcgggaaaaa tcgacaaatg tgagcttatc      2520
     gacggggacg ctcagattct cgcgatagag tacggagaga tatcacgctg a               2571
//

If you have problems or comments...

PBIL Back to PBIL home page