(data stored in ACNUC30630 zone)

EMBL: BX251410.PE27

BX251410.PE27        Location/Qualifiers
FT   CDS_pept        complement(26537..26869)
FT                   /transl_table=11
FT                   /locus_tag="TW027"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO4845 or SC5G8.13 SWALL:Q9KZA1
FT                   (EMBL:AL353872) (157 aa) fasta scores: E(): 2.9e-08, 41.3%
FT                   id in 92 aa"
FT                   /protein_id="CAD66719.1"
FT                   /translation="MLLGFRNIAYGSVLAASVAVIVSISFNWIGNRHLVFRGLRRDGVL
FT                   REAVRFFLVSIGGSLVQLACLVVSHYGMGFTSILADNIASNLVGLPLATVLRFIGYYFW
FT                   VFSKRK"
     atgctccttg ggttcagaaa tattgcatac ggctcagtgc ttgcggcgtc tgttgcggtt        60
     attgtttcaa tatccttcaa ttggattggc aatcgtcatt tagtttttag aggcttacga       120
     cgggatggtg tgctacggga agcggtgaga ttttttctgg tatcgatagg tgggtcgctt       180
     gtgcaactcg catgtcttgt tgtgtcccac tacggcatgg ggttcacgtc aatactggcc       240
     gacaatattg caagcaatct tgttgggctc ccgctagcaa cagttctgcg attcatcggg       300
     tactatttct gggttttttc caaacgtaaa tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page