(data stored in ACNUC30630 zone)

EMBL: BX251410.PE30

BX251410.PE30        Location/Qualifiers
FT   CDS_pept        complement(29078..29476)
FT                   /transl_table=11
FT                   /locus_tag="TW030"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66722.1"
FT                   /translation="MSRNVTCKPGMWEAVTLALVAYSSAIASILYFYSSPYATLAGGFA
FT                   LLSVGVLSFMSFRRPRILHSRRVWSVSAVFVFFLSALFLAFFVLSPGFGVSFSLSFLYG
FT                   VLLLATSLMSNLLLIGLICVRFPKHLEA"
     atgtcaagaa atgtaacatg taagcccggt atgtgggagg ctgttaccct cgcccttgtt        60
     gcttactctt ctgctattgc ctctattctt tatttctata gcagtccata cgcgaccctt       120
     gcgggcggtt ttgcgctctt atcggtcggc gtactatctt ttatgtcttt tcgccgacca       180
     agaatattgc atagcagacg ggtttggagt gtttctgctg tgtttgtatt cttcttgtca       240
     gctttgtttt tggcattttt tgttctctcc ccgggatttg gggtcagctt ttctctttcc       300
     ttcctctatg gcgtgttgct gttagcgact tcgttgatgt caaatctcct gcttattggc       360
     cttatctgcg tgcgcttccc gaaacattta gaggcctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page