(data stored in ACNUC30630 zone)

EMBL: BX251410.PE31

BX251410.PE31        Location/Qualifiers
FT   CDS_pept        complement(29804..30667)
FT                   /transl_table=11
FT                   /locus_tag="TW032"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="Similar to Streptomyces rishiriensis
FT                   dTDP-4-keto-6-deoxyhexose reductase CouS SWALL:Q9F8T1
FT                   (EMBL:AF235050) (288 aa) fasta scores: E(): 4.4e-46, 48.52%
FT                   id in 272 aa, and to Saccharopolyspora spinosa
FT                   dTDP-4-dehydrorhamnose reductase Kre SWALL:Q93EJ9
FT                   (EMBL:AF355468) (305 aa) fasta scores: E(): 4.2e-36, 43.34%
FT                   id in 293 aa"
FT                   /protein_id="CAD66723.1"
FT                   /translation="MSLKCLITGGGGMLGRDIRSVFPESVALTHDELDITDEYAVLDAA
FT                   RNKDLLINCAAYTQVDAAESNAAKAYAVNEAGARAVAKAAARRSIRVVHISTDYVFSGT
FT                   AIRPYPEDHPHSPLSVYGKSKAAGEKAVLEEYSKGSFIIRTAWLYGQYGNNFVKSILKA
FT                   CRTQDIVTVVNDQYGQPTWSLDLAKQIKLLAESDAPCGVYHGTNSGKTTWFDFAGKVAA
FT                   LGGYDPKRIIPISSAQFVRPARRPGYSCLGHDAWTAVGLEPMRPWEDALNDAWAAGVFA
FT                   ECIAGQ"
     ttgagtttaa agtgccttat aaccggtggc ggtggtatgt tggggcggga tatacggtct        60
     gtgttcccag agagcgttgc cctaacgcat gacgagcttg atataacgga tgaatatgct       120
     gttcttgacg ccgccagaaa taaagacctt ttaattaatt gtgctgcata tacacaggtt       180
     gatgcggcag aaagtaatgc tgcaaaagcc tatgcggtaa atgaagcggg tgcaagggct       240
     gtcgccaaag ctgcagcaag gcgttcaatt cgagtagtgc atatctcaac tgattatgtt       300
     ttttcaggaa cggcaatacg tccataccca gaagaccacc cgcattctcc cctttcggtc       360
     tacggaaaat ctaaggctgc tggagaaaag gcagtgttgg aggaatattc caaaggaagc       420
     tttatcatcc gtactgcttg gctctatgga caatacggca ataacttcgt aaaaagcatt       480
     ctgaaagcgt gtagaacaca ggatatcgtc acagttgtta acgaccaata tgggcaacca       540
     acttggagtc tggaccttgc aaaacagata aagcttcttg ccgagagtga cgctccatgt       600
     ggcgtgtacc atggaacaaa cagcggtaaa acaacctggt ttgattttgc cgggaaagtg       660
     gctgccttag gtgggtacga cccgaaacgc attattccca ttagctccgc acaatttgtg       720
     cgcccagcac gcaggcctgg atactcttgt ctgggccatg atgcatggac tgcagttggc       780
     ctggaaccca tgagaccttg ggaagatgcc ctgaatgatg catgggctgc gggtgtgttt       840
     gcggagtgta tagctgggca gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page