(data stored in ACNUC30630 zone)

EMBL: BX251410.PE32

BX251410.PE32        Location/Qualifiers
FT   CDS_pept        complement(30664..31647)
FT                   /transl_table=11
FT                   /locus_tag="TW033"
FT                   /product="putative dehydratase"
FT                   /note="Similar to Streptomyces tenebrarius AprE
FT                   SWALL:Q9F5R6 (EMBL:AF306787) (332 aa) fasta scores: E():
FT                   8.2e-88, 64.83% id in 327 aa"
FT                   /protein_id="CAD66724.1"
FT                   /translation="MTHILVTGGAGFIGSNFVRRAIENKYPEIRDCTVTVLDALTYSGN
FT                   INNLSPVRSSSRLRFIHGDIRDEDLLSEIMPNVNYVVHFAAETHVDRSIKNASAFVETN
FT                   VLGTGRLLEAAARNNIDRFIHISTDEVYGSIESGSWDENQPLLPNSPYSASKAASDLLV
FT                   RSYHKTYDLPVCITRCSNNYGPYQFPEKVIPLFVTNLIEDKEVPLYGDGTNVRDWLHVD
FT                   DHCRGIYIVLTKGRSGEIYNIGGGLELSNADLSQIILEVMEKSWSMVKRVKDRPGHDKR
FT                   YSVSINKISTLGYRPEVSFEQGLAETINWYKDNSSWWKPLKARAAL"
     atgacgcata ttcttgttac tggcggtgct ggatttattg gctctaactt tgtgcgcagg        60
     gcaattgaga acaaataccc ggagattaga gattgtacag tgacagtgct tgacgcgcta       120
     acttactcgg gcaatattaa caatttatct cctgtcagat cgtcgagtcg ccttcgattt       180
     attcatggtg atatacgtga tgaagatctc ctgagtgaga tcatgcccaa tgtgaactac       240
     gttgtgcatt tcgctgcaga aacacatgtt gataggtcaa ttaaaaacgc atcagctttt       300
     gtggaaacta atgtgcttgg tacagggcgg cttctggaag ctgctgcccg aaataacata       360
     gaccggttca ttcatatatc aactgatgag gtctatggtt cgattgaaag tggaagctgg       420
     gacgaaaatc aaccgcttct gccaaactcc ccgtactcgg catcaaaggc ggcaagtgac       480
     ctcttggtca ggagctatca caaaacctac gacctgccgg tttgcattac gaggtgctcg       540
     aataattatg ggccgtacca gtttccagaa aaagtcatcc ccctatttgt cacgaattta       600
     atagaagata aagaggtacc cctgtacggg gatggtacga atgtccggga ttggttgcat       660
     gttgatgacc attgtcgtgg tatttacatt gtgttgacaa agggtaggtc tggtgaaatc       720
     tacaatatcg gcggggggct tgagttgagc aatgccgatc ttagtcaaat tattctcgag       780
     gtgatggaga aaagctggtc gatggtaaag agggttaaag atcgccccgg tcacgacaag       840
     aggtatagtg tgtcaataaa caagatctct acgctcggtt ataggcccga ggtttcattt       900
     gaacaaggtc ttgctgagac aatcaattgg tataaggata atagctcttg gtggaagccg       960
     ctaaaggcta gggcggctct ttga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page