(data stored in ACNUC30630 zone)

EMBL: BX251410.PE34

BX251410.PE34        Location/Qualifiers
FT   CDS_pept        32571..33449
FT                   /transl_table=11
FT                   /locus_tag="TW036"
FT                   /product="putative nucleotidyl transferase"
FT                   /note="Similar to Streptomyces sphaeroides NovV
FT                   SWALL:Q9L9E6 (EMBL:AF170880) (297 aa) fasta scores: E():
FT                   6.5e-76, 66.78% id in 286 aa, and to Escherichia coli
FT                   glucose-1-phosphate thymidylyltransferase RffH or b3789
FT                   SWALL:RFFH_ECOLI (SWALL:P27831) (293 aa) fasta scores: E():
FT                   6.6e-69, 59.17% id in 289 aa"
FT                   /protein_id="CAD66726.1"
FT                   /translation="MKGIILAGGTGSRLWPITKCISKQLMPVYDKPMIYYPLSTLMMAD
FT                   IREILVITTTQDYDQFRRLLGDGGQWGIKLSYAQQLSPGGLAQAFLIGESFIASESIAL
FT                   VLGDNIFHGSGLGTSLRQHRSIQGALIFAYHVSNPKDYGVVTFDADGKAVSIEEKPESP
FT                   KSNFAVPGLYFYDNQVVDIAKQIPLSARGELEISSVNNFYLEKDQLRVYPLARGTSWLD
FT                   TGTFDSLVQASEYVRVIEQRQGFKVGCVEEIAWRAGWIDDDQLAKLANGLMKSGYGKYL
FT                   HYLLSGKHGFS"
     ttgaagggta ttatcctagc tggtggaacc ggatcaaggc tctggcccat aacaaaatgc        60
     atctcgaaac aattgatgcc tgtttacgat aagccgatga tctattatcc cctttccact       120
     cttatgatgg ccgatattcg ggaaatcctg gttataacaa ccacgcagga ttatgaccaa       180
     tttcgcagac ttttaggtga tggcgggcag tgggggatca agttgtcgta cgcacaacag       240
     ttgtcacccg gtggattggc ccaggcattt cttattggcg agtcttttat cgccagcgag       300
     agtattgcgc ttgtacttgg tgacaatata ttccacggaa gcggtcttgg tacatcgctt       360
     cgtcagcatc gaagcattca gggtgccctc atttttgctt atcacgtcag taatccaaag       420
     gattacggag ttgttacctt tgatgcagat ggtaaagcgg tatcaattga agaaaagcca       480
     gaaagtccaa aaagtaattt tgcagttccg ggactttatt tctatgacaa ccaggtagtt       540
     gatatagcaa aacagattcc tttgagcgct cgcggcgagc tggaaataag ttcagtgaat       600
     aacttttatt tagagaaaga tcagcttaga gtttatccat tggcccgtgg aacctcttgg       660
     ctcgataccg gcacatttga ttctcttgta caggcaagcg agtatgtccg cgttatagag       720
     caaagacagg gatttaaagt tggttgtgtc gaggaaatag cctggagggc tggatggata       780
     gatgatgatc agctggccaa acttgcaaat gggcttatga aaagtggtta tgggaagtat       840
     ttgcactacc tcctgagcgg taagcacggg ttttcataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page