(data stored in ACNUC30630 zone)

EMBL: BX251410.PE35

BX251410.PE35        Location/Qualifiers
FT   CDS_pept        complement(33457..34305)
FT                   /transl_table=11
FT                   /locus_tag="TW037"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to Mycobacterium smegmatis
FT                   dTDP-rha:a-D-glcnac-diphosphoryl polyprenol,
FT                   a-3-L-rhamnosyl transferase WbbL SWALL:Q9RN50
FT                   (EMBL:AF187550) (296 aa) fasta scores: E(): 2.3e-30, 36.66%
FT                   id in 270 aa"
FT                   /protein_id="CAD66727.1"
FT                   /translation="MTMIARFELITVTYNCSDILRDFLVSVQDSEPNRVSVTVVDNNSH
FT                   DRSICKDYARQFGARFIALEKNSGYGAAVNAGAKRLPSNIEYIGICNPDLALEKGTIST
FT                   LLSVFEQDKDAVAAGPCILNQDGTPYPSARDIPGISNGVGHALFKNIWPDNPWTRSYTQ
FT                   SALGTKRRTCGWLSGAFFIIRRNAFEDVGGFDEGFFMYFEDVDLFSRLQKRPRYEPNAK
FT                   VKHIGRYSTRQNPKTMLFFHHKSAGRFLDKKYSKKWQKPVTFLLKLGLKLRYRLQARKL
FT                   K"
     atgacaatga tcgctcgatt cgagcttata accgtaacat acaactgctc tgatatcttg        60
     agagattttt tagtatcagt ccaagattcg gaacccaatc gagtgagtgt aactgttgtt       120
     gacaataact cacatgatag aagtatctgc aaagattatg cccgacagtt tggtgctagg       180
     tttatcgcac tagagaaaaa ctccggatac ggcgcagcgg tcaatgcggg cgccaagagg       240
     ctgccaagca atatagagta catcgggatt tgtaatcctg atttagcgct ggagaaggga       300
     actattagca ctctcttgag tgttttcgaa caggataaag atgctgtcgc tgcgggccca       360
     tgcattctaa atcaggacgg tactccatat ccatccgcac gtgatattcc aggcatttca       420
     aacggggttg gtcatgcatt gtttaaaaat atatggccgg acaatccatg gacccgcagc       480
     tatacccaga gcgctctcgg gacaaaaaga cggacctgcg gatggctcag tggggcgttc       540
     ttcatcatac gcagaaatgc attcgaagat gtgggcggat tcgatgaggg gttttttatg       600
     tatttcgagg atgtcgactt gttttcacgt ctacagaaaa gacctcgcta cgagccaaat       660
     gcgaaagtca agcatatagg tagatattca actcggcaaa acccaaaaac aatgcttttt       720
     tttcaccaca aatctgcggg gcgctttctt gacaagaaat actcaaaaaa atggcagaaa       780
     cccgttacat tccttctgaa acttggactg aaactcaggt accgtctaca ggcaagaaaa       840
     ctgaagtag                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page