(data stored in ACNUC30630 zone)

EMBL: BX251410.PE36

BX251410.PE36        Location/Qualifiers
FT   CDS_pept        complement(34302..35108)
FT                   /transl_table=11
FT                   /locus_tag="TW038"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /note="Similar to Myxococcus xanthus O-antigen export
FT                   system ATP-binding protein RfbB SWALL:RFBB_MYXXA
FT                   (SWALL:Q50863) (437 aa) fasta scores: E(): 2.3e-30, 48.92%
FT                   id in 233 aa"
FT                   /protein_id="CAD66728.1"
FT                   /translation="MKNKMSVVNSNAVKLAKSKHYTGVTNDNAILRVSNVSKKFVIQHN
FT                   RSIKERLLNFRVSRANREPFWALKNITFELPIGSSVGLVGHNGSGKSTLLKLIGGIVRA
FT                   TEGEILSRGRISALIELGAGFHPDLTGRENIYLNGSILGLTKAEIRRNFDSIVDFSGIE
FT                   KFIDTQVKFYSSGMYMRLAFSVSVHTDPDLLLIDEILAVGDAPFQKKCLNKVTQFKNEG
FT                   RSIVMVSHVAEQIETVCDKVMVLKNGRLIYYGTTKVGLDLLRENYQ"
     atgaaaaata agatgtcagt ggtaaatagt aatgcggtaa aactggcgaa gtcgaagcac        60
     tataccggtg tgacaaatga caatgcgata ctgcgagtca gtaatgtatc gaaaaaattt       120
     gtaatacagc ataataggtc aatcaaagag agactgctta atttcagggt ttcccgggca       180
     aacagagagc cgttttgggc tctaaaaaat ataacctttg agttgccaat tggtagctcc       240
     gttggtcttg tggggcacaa tggctccggg aagtcaactc ttctgaagct aataggtggc       300
     atagtaaggg caacagaagg tgaaatactg agccgcgggc ggataagcgc cctcattgaa       360
     ctgggtgccg gatttcaccc cgatctcacc ggaagagaga atatatacct gaacgggtca       420
     atcttggggc taacaaaagc agaaataaga cggaattttg actcaattgt tgacttttcg       480
     gggatagaaa aattcattga tacacaggtc aaattttata gctcaggtat gtatatgcga       540
     cttgcgtttt ctgtgtctgt acatacagac ccagaccttt tgttgattga tgagattctt       600
     gctgtcggcg atgcgccatt tcaaaaaaag tgtctcaata aggttaccca gttcaaaaat       660
     gaagggcgaa gcattgttat ggtaagccat gtagccgaac agatagagac tgtatgcgat       720
     aaggtcatgg tcttgaaaaa tggaagattg atctactatg gcacaacaaa agtcgggctg       780
     gatttactaa gagaaaacta tcaatga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page