(data stored in ACNUC30630 zone)

EMBL: BX251410.PE37

BX251410.PE37        Location/Qualifiers
FT   CDS_pept        complement(35160..36041)
FT                   /transl_table=11
FT                   /locus_tag="TW039"
FT                   /product="putative ABC transport integral membrane subunit"
FT                   /note="Similar to Pseudomonas aeruginosa membrane-spanning
FT                   domain Msd Wzm SWALL:P72162 (EMBL:U63722) (265 aa) fasta
FT                   scores: E(): 8.6e-21, 30.68% id in 277 aa, and to
FT                   Myxococcus xanthus O-antigen export system permease protein
FT                   RfbA SWALL:RFBA_MYXXA (SWALL:Q50862) (260 aa) fasta scores:
FT                   E(): 1.2e-15, 26.83% id in 272 aa"
FT                   /protein_id="CAD66729.1"
FT                   /translation="MPENLIRARLLSKPLKPVGETGMSSLKGMWQRRALLSLLIQREIK
FT                   IRYKGTAFGVLWSMARPIVQLLVYYFAIGKILGAERGIDQFAIFIFVGFATWSLFAEIA
FT                   STAVVCMTNNGGLIKKIYLPRELFVVTALGNALFTFSIYILILMVAAPVLGQMPIDPTK
FT                   WQGFVGIGIAIVYATALGLVLAPLNVYMRDAQHFLDVALSILFWLTPIVYSFQRVNGAV
FT                   HSNIAEQLYLLNPMAIAVMGMQKTFWTAGSSVHWPADIDARLIIVFLVGLLLLFLAHRI
FT                   FVKMQANLAQEL"
     atgccggaaa acttgataag agccaggtta ttatcaaaac ctttgaaacc agttggcgag        60
     acgggcatgt cttccttaaa ggggatgtgg caaaggcgtg cacttctgtc tttactcatc       120
     cagcgcgaaa tcaagattcg ctataaagga actgcatttg gcgttttgtg gagtatggca       180
     aggccgattg ttcagcttct ggtctattat ttcgcaattg gcaaaatact cggtgccgaa       240
     aggggaatcg atcagtttgc aatatttatt ttcgttggat ttgccacctg gtctctgttc       300
     gcagagatag catctactgc tgttgtttgc atgactaata atgggggttt aatcaaaaag       360
     atttatttac caagagagct atttgttgta actgcgcttg gtaatgcact gtttactttt       420
     tccatttaca tacttatact catggtggct gctcccgtgc tcggccaaat gccgatagat       480
     ccaacaaaat ggcaggggtt tgtggggata ggcattgcta ttgtttacgc aaccgctctt       540
     gggcttgttt tggcacctct gaatgtttat atgagagatg cacaacattt tctggatgtt       600
     gcactctcga tactgttctg gctaacaccg attgtgtatt cattccaacg agttaatggg       660
     gcggtacact caaatattgc ggagcaattg tatcttctaa acccaatggc aatagcagtt       720
     atgggcatgc aaaaaacatt ttggactgct ggaagcagcg tgcattggcc tgcggacatt       780
     gacgcacgtc ttattattgt ttttcttgtc gggctcttgt tactgttttt agcccacagg       840
     atttttgtta agatgcaggc gaacttggcg caagagctgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page