(data stored in ACNUC30630 zone)

EMBL: BX251410.PE40

BX251410.PE40        Location/Qualifiers
FT   CDS_pept        complement(37548..38276)
FT                   /transl_table=11
FT                   /locus_tag="TW042"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to Actinobacillus actinomycetemcomitans
FT                   putative glycosyltransferase SWALL:Q9AQB2 (EMBL:AF213680)
FT                   (234 aa) fasta scores: E(): 6.3e-16, 28.99% id in 238 aa"
FT                   /protein_id="CAD66732.1"
FT                   /translation="MTNRVLVVVPAHNEALSLPGTLQEIKENLPGFSVLVIDDGSTDAT
FT                   SDAAEAHSIKVIRIPFNAGVGGAMRLGFRFALRKGFNVVVQVDADGQHNPKYVSELINR
FT                   LNNRHDKPDIVIGARFAGCGNYKLRGPRRWAIFALSKLMSRFAKTNLTDVTSGFRASGT
FT                   RAIKLFAEKYPTEYLGDTVESVAIALKEGLVVRQVPVAMRERKAGTPSHGPCRATLLLL
FT                   RVVVAALVAPLKSGKSKGCR"
     gtgacaaata gggtgctggt tgtcgttccg gcacataatg aggccttatc cctccctggg        60
     accttgcaag agataaaaga gaatctaccg ggatttagtg ttttggtaat agacgacggg       120
     tcgacagatg caacatctga tgcagcggag gcgcattcga taaaagtaat caggataccg       180
     ttcaatgctg gagtaggcgg ggcaatgcgt cttggcttca gatttgccct cagaaaagga       240
     tttaacgttg ttgttcaggt tgacgctgac ggacagcata acccaaagta cgttagtgaa       300
     ctgataaata gactgaacaa tagacatgac aaacccgata ttgtgatagg ggctcgcttt       360
     gcgggatgcg gaaactacaa actaagaggg ccaagacgtt gggcgatatt tgctctcagc       420
     aaacttatga gtcgctttgc caagactaat ctaactgatg ttacaagcgg ttttcgcgca       480
     tctggaacaa gagcaattaa actatttgcc gagaaatatc caaccgaata cctcggtgat       540
     acagtcgagt cggtggcaat tgcccttaaa gaaggtcttg tggtgagaca ggttcctgtt       600
     gcgatgcgcg aaaggaaggc cggtactcca tcgcatgggc catgcagagc gaccctgttg       660
     ttgttgagag tagttgtggc agcgcttgtg gcacccctga agtctggaaa gtcgaaaggc       720
     tgtcgatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page