(data stored in ACNUC30630 zone)

EMBL: BX251410.PE41

BX251410.PE41        Location/Qualifiers
FT   CDS_pept        38634..40475
FT                   /transl_table=11
FT                   /locus_tag="TW043"
FT                   /product="putative large integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66733.1"
FT                   /translation="MRMSDSDTNSIPLTRSALRKIEKSSAAGASGLRRLRLAVLVPLLL
FT                   FISLAGWALSSPIGSSPDDDFHLASAWCALGDRPGLCESSGIKDAKKVPTTILDTWHGK
FT                   GSRHGNLYCFLNGVSPECQNKWLGNTDHKMQDTGRVNFGNNAQYTNLYYSAMGLLASDD
FT                   VRASVWGMRLINAFIFTALSLLLYLALPQPRRAALLITWSLSLVPAAMFFIPSSNPSSW
FT                   AFIGVPSTFFAMLSFFETRGRRKICLGIIAVFSVLLSAFARSDAAIYALLAIVISGILQ
FT                   VRDFKNPWAQFALPVALGIMSIATFFMYPLNVAATGLPATGARDYGFITFVKNIIFIPS
FT                   SFLPSVFTPQFLGWLDVPLYPPAYVFVAIAALIVVGFALGVGGVRKLFAVLLTLAALII
FT                   APLYVSQVAGITADKLLQPRYLAPLAIIFIAVVLYTGFGEVLQIKKRYMAVIFFLIAPA
FT                   NAFGIFSLLRHYDALPSFLGGALPPTSDGPNAGASRDALAGHHPPGSISAPDGAGTSGE
FT                   HSGSWWWPGFPVSPILLFSVVVASFTLALLIALRDVLKIRNEVNIANETEKALARARRL
FT                   SVSDTPALVNVGTGMITLSKISNATASITLEDAEDQS"
     gtgcggatga gtgacagtga tacgaatagc attccgctta cacgttcggc gctgcgcaaa        60
     atagaaaaaa gtagcgccgc cggggcgtcg ggactgcgac gattgcgcct ggcggtgctt       120
     gttccgctgt tgctgtttat ttctctggca ggctgggccc tctcttcccc gattggaagc       180
     agccccgatg atgatttcca tctcgccagt gcatggtgtg ccctcggtga caggcctggc       240
     ttatgtgaat catctggcat aaaggatgct aaaaaggttc ccactacgat tttggacacc       300
     tggcatggta aaggtagccg ccatggcaat ttgtattgtt tcctaaatgg tgttagccca       360
     gagtgtcaga acaaatggct tggcaatact gatcacaaga tgcaggatac cggtcgtgtt       420
     aactttggca ataatgcaca gtatacgaat ctttattact cagctatggg tttattggcc       480
     tctgatgatg tgcgcgcttc cgtatggggc atgcggctta taaacgcctt tatattcacc       540
     gctctgagtt tgctacttta tcttgcattg ccgcagccgc gcagggcggc tttgctgatc       600
     acatggtcac taagccttgt tccggccgca atgtttttca taccctcgtc taacccatca       660
     tcatgggcgt ttatcggggt accgtcgacc tttttcgcaa tgctttcctt ctttgaaact       720
     cggggtagga gaaaaatttg cctcggcatt atcgcggttt tttcagtttt gctatcagct       780
     tttgccaggt ctgatgcagc catctatgcc cttctggcaa ttgtaatcag cggaatcttg       840
     caggtgcggg attttaaaaa cccctgggct cagtttgcat tgccggttgc tcttggcatt       900
     atgtccattg ctacattctt tatgtatccg ctaaatgttg cagcgactgg acttcctgct       960
     actggcgcta gagactatgg ctttataacc ttcgttaaaa acattatttt tataccgagt      1020
     tcttttttac cgagcgtatt taccccgcag ttcctggggt ggcttgatgt gcccctgtat      1080
     ccccctgcat atgtgtttgt cgccattgca gcgctaattg tcgttggatt tgcccttggg      1140
     gttggagggg tgcgcaagct atttgcggtt ctgctgactc ttgcggcatt gattatcgcg      1200
     ccattgtatg tatctcaagt tgcggggatt accgctgata aactgcttca gccgagatat      1260
     ttagctcctc ttgcgattat cttcattgct gtggttctgt ataccggctt tggtgaggtc      1320
     ctccagataa agaaacgata tatggctgtt attttttttc taattgcccc cgctaacgca      1380
     ttcggtattt tttccctgct caggcattat gatgccctgc caagtttttt gggtggcgct      1440
     ttaccgccta catcagacgg gcccaatgcg ggcgccagcc gcgatgcgct cgctgggcat      1500
     cacccccccg gatccatttc tgcgccggat ggggctggta cttctggtga acattcggga      1560
     tcatggtggt ggcctgggtt tcccgtttct ccgattttgc ttttcagcgt agttgttgca      1620
     tctttcacgc ttgcattgtt aattgccttg cgcgatgtgc tcaaaatacg caatgaggtg      1680
     aatatagcga atgaaaccga gaaggctttg gcacgtgcca ggcgtctgag cgtatctgac      1740
     acgccagcgc ttgtcaatgt tggaaccgga atgataaccc tttccaagat atctaacgca      1800
     acggcctcta taacgctcga ggatgcagaa gaccaatcgt aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page