(data stored in ACNUC30630 zone)

EMBL: BX251410.PE42

BX251410.PE42        Location/Qualifiers
FT   CDS_pept        40712..40825
FT                   /transl_table=11
FT                   /locus_tag="TW044"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66734.1"
FT                   /translation="MKGNHVMHAPGNAVKTFDPEGCLYGASSGAVGGFDLV"
     gtgaagggca atcatgttat gcacgcgcct ggtaacgctg taaaaacctt tgaccctgaa        60
     ggatgtctat acggcgcatc cagtggtgca gttggcggtt ttgacctggt ttaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page