(data stored in ACNUC30630 zone)

EMBL: BX251410.PE44

BX251410.PE44        Location/Qualifiers
FT   CDS_pept        41326..41835
FT                   /transl_table=11
FT                   /locus_tag="TW046"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66736.1"
FT                   /translation="MQKTHPYNMYMFGEIFKQRALEVKRSIGQMPRLPRACFIATPPLV
FT                   LVKMVILVTLWSFWWMWPILFSIIAIDWAVSAVGVFSARRWAKHNPDKLLNLKWAVYPF
FT                   VFIIALFAFIRPFLLMGGYILLMFFALPIGGMIRMFALLAIMSGAKPKPISMLRRAIKG
FT                   RKKRDL"
     atgcagaaga ctcacccata caatatgtat atgtttggcg aaatattcaa gcagcgcgca        60
     ctggaggtaa agcgatccat tgggcagatg ccgagattgc ccagggcatg ctttattgca       120
     acaccgcccc ttgttctagt caagatggtg attcttgtta cgctgtggtc attctggtgg       180
     atgtggccta ttctattttc gataattgcc attgactggg cagtttccgc ggtcggcgta       240
     ttttctgcca ggcgctgggc gaaacacaat ccagataaat tgctcaacct caagtgggct       300
     gtctatccgt ttgtttttat aattgcgctg ttcgctttta ttcgcccctt tttactgatg       360
     ggaggctata tcctgctgat gttttttgcg cttccgattg gcggcatgat cagaatgttt       420
     gctctgctag caattatgtc gggggctaag cctaagccta tctcaatgct gcgacgtgcc       480
     ataaagggaa gaaagaagcg tgatctctaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page