(data stored in ACNUC30630 zone)

EMBL: BX251410.PE45

BX251410.PE45        Location/Qualifiers
FT   CDS_pept        42189..42587
FT                   /transl_table=11
FT                   /locus_tag="TW048"
FT                   /product="putative secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66737.1"
FT                   /translation="MKKLTTVSITVLSIVTLLFIAQPAQASEGNLEANQGTKLKRVTRS
FT                   VKTFDVDKCLNGAVSGAVGVGGGFAGAQAAKLIIKGVSAVNPATFAAVTAGTAVADCVM
FT                   HGGLVDDVVNGFNAGFNAVGDFIGKLFG"
     atgaagaaac ttaccactgt atctattact gttctctcta tcgttaccct attattcata        60
     gcccaacctg cccaggcaag tgaaggtaat ctggaagcta atcaaggcac aaaactcaag       120
     agagtcacca gaagcgtaaa aacatttgat gttgataagt gcctcaatgg cgctgttagc       180
     ggtgcagttg gggtgggtgg cggttttgcc ggcgcgcagg ccgctaaatt gataatcaag       240
     ggcgtcagcg ccgttaatcc ggcgaccttt gctgccgtaa cagcagggac tgctgttgct       300
     gattgcgtta tgcacggtgg gcttgttgat gatgttgtca atgggtttaa tgctggattt       360
     aacgccgttg gtgacttcat aggaaagctg ttcggatga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page