(data stored in ACNUC30630 zone)

EMBL: BX251410.PE46

BX251410.PE46        Location/Qualifiers
FT   CDS_pept        42584..42982
FT                   /transl_table=11
FT                   /locus_tag="TW049"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66738.1"
FT                   /translation="MNASTLGGRLKNSRLFIVACMLLLIPLFIYVVLSGYSLGYAFGAA
FT                   LALAFTCPGVVRSVFNGSFSLDLGNPFLAAIGLLGAGYLILMTLSPVLWLLFSQTFMFY
FT                   FNAVMFTMLFVALQCALARWAVLSRRAG"
     atgaatgcct ctacattggg cggtagactc aaaaacagca ggctgtttat tgttgcttgc        60
     atgctcttat tgattccgtt gtttatttat gtcgtactgt caggttattc cttaggttac       120
     gctttcggtg ctgcactcgc tcttgcgttt acgtgtcctg gagtcgtgcg ttctgttttt       180
     aatggttcgt tctcgcttga tctgggtaac ccttttcttg ccgcgattgg cctcttgggc       240
     gccggatacc ttattctcat gaccctgagt cctgtactct ggcttttatt cagtcagact       300
     tttatgtttt atttcaatgc cgtcatgttt accatgttgt ttgttgcttt gcagtgtgca       360
     cttgcgcggt gggctgtact aagccgccgg gctggctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page