(data stored in ACNUC30630 zone)

EMBL: BX251410.PE47

BX251410.PE47        Location/Qualifiers
FT   CDS_pept        43109..43420
FT                   /transl_table=11
FT                   /locus_tag="TW051"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66739.1"
FT                   /translation="MDSQQIGLNNFVLRNLLLGFVATVCILFPIAFVLVAGRDWHAVPL
FT                   VFVVLMAICPLFIFDYRFVSGKFKVIVGLSWAAAIFFCAFTILTGIAFLFFGFPDISH"
     gtggattcgc aacagatagg cttgaataat tttgtgctca ggaacctgct gttaggcttt        60
     gttgcaacgg tatgcatact gttccccatt gcttttgtgc ttgttgctgg ccgtgactgg       120
     catgcagtcc ctcttgtttt tgtggtgctt atggcaatct gtccattgtt tatattcgat       180
     tatcgttttg tctccggcaa atttaaggta attgttggac tttcctgggc ggctgcaata       240
     ttcttttgtg ccttcactat cctgacaggt attgcatttt tgttttttgg ctttccagac       300
     atatcacatt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page