(data stored in ACNUC30630 zone)

EMBL: BX251410.PE48

BX251410.PE48        Location/Qualifiers
FT   CDS_pept        43784..44215
FT                   /transl_table=11
FT                   /locus_tag="TW052"
FT                   /product="putative secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66740.1"
FT                   /translation="MKKLTTVSITVLSIVTLLFIVQPAQARGGAGHISVVARGGNTYIT
FT                   ATIREGFDLDECLKGAVTEVFDVGTGSHMGFLGRLVKIVVKGARFAGPIGTAIGTSIDV
FT                   ITGCLKQGIVPDKPQIPHVNSVCTVNIFSHRPGHSCYKR"
     atgaagaaac ttaccactgt atctattact gttctctcta tcgttaccct gttattcata        60
     gtccaacctg cgcaggcaag agggggcgca gggcatattt ctgttgttgc caggggcggc       120
     aatacctaca ttactgccac tattcgtgaa gggtttgatc ttgacgaatg cctgaagggt       180
     gccgttacag aggtttttga tgtcggcacc ggtagtcata tggggttttt gggaagactg       240
     gtaaaaattg ttgtaaaagg tgcgcgcttc gcgggcccta tcgggactgc gattggtacc       300
     agcattgatg taattaccgg ttgtctaaag cagggtattg ttccggataa accgcagata       360
     ccccatgtaa attcagtctg cactgttaac atcttctccc acagaccggg tcatagctgt       420
     tataagaggt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page