(data stored in ACNUC30630 zone)

EMBL: BX251410.PE49

BX251410.PE49        Location/Qualifiers
FT   CDS_pept        44219..44608
FT                   /transl_table=11
FT                   /locus_tag="TW053"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66741.1"
FT                   /translation="MARITRNTSVPVLILCCLLSIPLLAIVGVILVLAGSELWFIPAFV
FT                   LFLMFIFGPEHHVTDYNLWEALFAGLIMGGSLAMLTTCSVVNFVYPELWLLRSPGFSIA
FT                   CTVAFAIAAAFFLAVDLRRKIKQGQ"
     gtggcgcgca tcacacgtaa tacctcagtg cctgtgctga tcctgtgttg tttgctgtca        60
     atcccccttc ttgctatcgt cggggtgatt cttgttctcg ccggtagcga attgtggttt       120
     atcccagcct ttgttctgtt cttgatgttt atatttggac ctgagcatca tgttactgat       180
     tacaacttat gggaagcact ttttgccggg cttataatgg gcggatctct tgcaatgctt       240
     acgacctgct ctgtcgttaa ttttgtttat cctgaattat ggttattacg ctcgccaggt       300
     ttttctattg cctgcactgt cgcatttgcc attgctgccg cttttttcct ggcggtagat       360
     ttgcgtcgca agataaaaca gggccagtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page