(data stored in ACNUC30630 zone)

EMBL: BX251410.PE50

BX251410.PE50        Location/Qualifiers
FT   CDS_pept        complement(44860..46251)
FT                   /transl_table=11
FT                   /locus_tag="TW054"
FT                   /product="putative two component system sensor kinase"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   protein Rv0758 or mt0783 or mtcy369.03 SWALL:P71815
FT                   (EMBL:Z80226) (485 aa) fasta scores: E(): 8.9e-37, 31.11%
FT                   id in 466 aa, and to Streptomyces coelicolor putative two
FT                   component system histidine kinase SCO4021 or 2SC10A7.25
FT                   SWALL:Q9ADN6 (EMBL:AL583945) (524 aa) fasta scores: E():
FT                   5.5e-27, 37.73% id in 265 aa"
FT                   /protein_id="CAD66742.1"
FT                   /translation="MVTLVALVLAFSFTAVGIGTTLVIKNEMIKTIDEQLIHISGTFPL
FT                   FESSFEVFSPGRASYKAHIYKFDGTLIWPIGENPSIEFDRKIDITLYNEKGNTPFTLHS
FT                   ISRQKKYRMLLQPLETGSGQEILAYYLPQSGTENTANFYQRSYIWFSLAVFAIAAYIVY
FT                   LITAHTLSPLYALEKTARAFARGDYSRRIRSEYVSAEILNLNKSLNSMLDSLEKALGER
FT                   DKTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIERIEKEAIRMGT
FT                   MVEDLLSLTRLEKATDLVPVDVKYLVQESVIDMNVLEKTRKITTGIPKRQSCMILGNEN
FT                   MLRRLLANLINNALHYTPPGSPIEIVLRTDKTDVVIDVRDHGPGVPRQLHDKVFKRFWR
FT                   SDASRARNSGGVGLGLSIVASIVKVHKGTIEILRTRGGGATFRTRIPKLVNKHRSGSSS
FT                   HSLTR"
     gtggtaacgc ttgtagcgct tgtgcttgca ttttcgttca ctgctgtggg tattggaacc        60
     actctggtta taaagaacga gatgataaaa acaattgatg agcagctaat tcatataagc       120
     ggtacatttc cgctgtttga aagcagtttt gaagtgttca gtccgggaag ggcaagctac       180
     aaagctcata tttataaatt cgacgggaca ctgatttggc ctatcggaga aaacccttct       240
     atcgagtttg acaggaaaat tgacattaca ctttacaacg aaaagggtaa cacgccgttt       300
     actttgcact cgatatcgag acaaaagaaa tatagaatgc tcttgcagcc actggaaacg       360
     ggcagtgggc aagaaatcct tgcttattac ctgccgcagt ctggtactga aaataccgcc       420
     aatttttatc aaagaagcta tatttggttt agtcttgcgg tatttgcaat cgctgcgtac       480
     atagtttatc taataaccgc acatacacta tctccactat atgctcttga gaagaccgca       540
     agggcgtttg caagagggga ttattcaagg cggataaggt ctgaatatgt ttctgcagaa       600
     atactcaatc taaacaaatc tctgaattcc atgctggaca gtctcgaaaa agcccttggt       660
     gagcgagata aaacacttgg cgagatgaag caattcttgg cagatgcaag tcacgaattg       720
     cgaacgccac ttgtatctct taggggttat gccgagctct ataggattgg cgcccttaag       780
     ggtaaggagg atattgacaa cgcgattgag cggattgaaa aagaggcaat acgaatgggc       840
     acaatggttg aagacttgct gtctctgacg cgccttgaaa aggctacaga ccttgtgcct       900
     gtcgatgtga aatatcttgt ccaagagtca gttattgaca tgaatgtcct ggaaaaaact       960
     cgtaagatca caaccggtat tccgaaaagg caatcctgta tgattctcgg gaacgaaaat      1020
     atgcttcggc ggttacttgc aaatctgatt aacaatgccc tgcactatac cccgccaggc      1080
     tctccaatag agattgtgtt acgcactgat aaaacagatg ttgtgattga tgtgcgcgac      1140
     catggtccgg gcgtgccaag acagctacac gataaagtgt tcaagcggtt ttggcgatct      1200
     gacgcatcgc gggcacggaa cagcggtggt gtggggcttg ggctttctat tgtggcatct      1260
     attgtaaaag tccataaagg cacaatagag atattgcgca cacgaggtgg tggcgctaca      1320
     tttagaacca ggattcccaa gcttgttaat aaacaccgtt ctggatcctc tagtcatagt      1380
     ctcacacggt ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page